Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma, large-cell 6,234

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.500 0.000

Synonym

Accession Q8NEP4 Q8N821
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MVKTNKPGAKVAVSAQRGSEVTTNTSPQQGHGYVLASSHRSAAVSLNPSHRRSEAAHPTTPHSASDYPRS      1 - 70
VSLQSGPGHYAVPTPRGPETGPRTESSRHSSPHLKSQKTQTLASHASSRQWKVSPPREEAARRGSESKSG     71 - 140
REVGHHASSIPDAKSTHQLSFQDQKNNLQSQILEDDPPSKVQNPQGVRVPRRILSYPKDEAVQTEPIQRI    141 - 210
TTTSEIRSPRSPSLLEHGSSCVSADYQTAQRRVPVEESETGPYGPIPSKPKALYRNMNLDSLLKLSVLKD    211 - 280
SDGVHRVSARVDPESLHKYSAYPETKPSAKVLVSSQVESNVRTPIRGNSEVGRRVTISPGVQSVEPTHHV    281 - 350
TVPSVSEGSHKSSMFVTPEPIYKQQTQKPPEITYMSQGPTPRYPELSQKPSIHAELELTPRPLPPRSLPR    351 - 420
YGPDSSWWPLLNPEVETPQSQLTTPDFEPKCSPSLDLLLSGFKIDSSPFCEDLKFQREKASLSPPSPPKE    421 - 490
FPSWAPLSEVPQTPKHTCKQPIQRFTAFFLDVSEEMYNRVIWWLKGLCFSLLWAHCGSLGDGRTGEEWHL    491 - 560
CIYRAGSFRR                                                                561 - 570
//

Text Mined References (6)

PMID Year Title
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.