Property Summary

NCBI Gene PubMed Count 10
Grant Count 15
R01 Count 13
Funding $1,800,381.5
PubMed Score 11.24
PubTator Score 8.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 2.600 0.000
tuberculosis and treatment for 3 months -2.200 0.000
group 3 medulloblastoma -1.200 0.015
nasopharyngeal carcinoma -1.300 0.000
lung carcinoma -1.500 0.000
pituitary cancer -1.100 0.000
chronic rhinosinusitis -1.196 0.041

 GO Function (1)

Gene RIF (3)

PMID Text
19944405 LRRC50, a member of the leucine-rich-repeat superfamily, has a key role in cytoplasmic preassembly of dynein arms
19944400 LRRC50 plays a role in assembly of distinct dynein-arm complexes
18385425 It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli

AA Sequence

MHPEPSEPATGGAAELDCAQEPGVEESAGDHGSAGRGGCKEEINDPKEICVGSSDTSYHSQQKQSGDNGS      1 - 70
GGHFAHPREDREDRGPRMTKSSLQKLCKQHKLYITPALNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNG     71 - 140
IQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETV    141 - 210
EDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLTYLDD    211 - 280
RPVFPKDRACAEAWARGGYAAEKEERQQWESRERKKITDSIEALAMIKQRAEERKRQRESQERGEMTSSD    281 - 350
DGENVPASAEGKEEPPGDRETRQKMELFVKESFEAKDELCPEKPSGEEPPVEAKREDGGPEPEGTLPAET    351 - 420
LLLSSPVEVKGEDGDGEPEGTLPAEAPPPPPPVEVKGEDGDQEPEGTLPAETLLLSPPVKVKGEDGDREP    421 - 490
EGTLPAEAPPPPPLGAAREEPTPQAVATEGVFVTELDGTRTEDLETIRLETKETFCIDDLPDLEDDDETG    491 - 560
KSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFKKEAK    561 - 630
RDLEIRKQDTKSPRPLIQELSDEDPSGQLLMPPTCQRDAAPLTSSGDRDSDFLAASSPVPTESAATPPET    631 - 700
CVGVAQPSQALPTWDLTAFPAPKAS                                                 701 - 725
//

Text Mined References (12)

PMID Year Title
25186273 2014 Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia.
23872636 2013 DYX1C1 is required for axonemal dynein assembly and ciliary motility.
19944405 2009 Loss-of-function mutations in the human ortholog of Chlamydomonas reinhardtii ODA7 disrupt dynein arm assembly and cause primary ciliary dyskinesia.
19944400 2009 Deletions and point mutations of LRRC50 cause primary ciliary dyskinesia due to dynein arm defects.
18385425 2008 LRRC50, a conserved ciliary protein implicated in polycystic kidney disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...