Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.75
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-04
Breast cancer 2.000 3.9e-02
colon cancer 1.700 3.1e-02
group 4 medulloblastoma -1.200 9.9e-04
lung cancer 1.700 3.4e-03
medulloblastoma, large-cell -1.200 2.4e-03
non primary Sjogren syndrome sicca 1.100 2.6e-02
osteosarcoma -2.754 1.6e-06
ovarian cancer -1.600 3.6e-05
pancreatic ductal adenocarcinoma liver m... -2.102 4.5e-02
psoriasis -1.300 1.5e-03
spina bifida -1.009 2.3e-02
tuberculosis and treatment for 6 months 1.200 8.5e-03

 GO Function (1)

 GO Component (2)

Gene RIF (8)

AA Sequence

MGLLLMILASAVLGSFLTLLAQFFLLYRRQPEPPADEAARAGEGFRYIKPVPGLLLREYLYGGGRDEEPS      1 - 70
GAAPEGGATPTAAPETPAPPTRETCYFLNATILFLFRELRDTALTRRWVTKKIKVEFEELLQTKTAGRLL     71 - 140
EGLSLRDVFLGETVPFIKTIRLVRPVVPSATGEPDGPEGEALPAACPEELAFEAEVEYNGGFHLAIDVDL    141 - 210
VFGKSAYLFVKLSRVVGRLRLVFTRVPFTHWFFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIK    211 - 280
RKHTLPNYKIRFKPFFPYQTLQGFEEDEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLE    281 - 350
LSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDRLIAIG    351 - 420
GVKITSTLQVLKLIKQAGDRVLVYYERPVGQSNQGAVLQDNFGQLEENFLSSSCQSGYEEEAAGLTVDTE    421 - 490
SRELDSEFEDLASDVRAQNEFKDEAQSLSHSPKRVPTTLSIKPLGAISPVLNRKLAVGSHPLPPKIQSKD    491 - 560
GNKPPPLKTSEITDPAQVSKPTQGSAFKPPVPPRPQAKVPLPSADAPNQAEPDVLVEKPEKVVPPPLVDK    561 - 630
SAEKQAKNVDAIDDAAAPKQFLAKQEVAKDVTSETSCPTKDSSDDRQTWESSEILYRNKLGKWTRTRASC    631 - 700
LFDIEACHRYLNIALWCRDPFKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTA    701 - 770
LRNLSMQKGFNDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENK    771 - 840
HSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETSVCGATDRRIDRTLKNLRLEGQ    841 - 910
ETLLGLPPRVDAEASKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGS    911 - 980
DTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQE    981 - 1050
LEHNNSLVREEKETTDTRKKSLLSAALAKSGERLQALTLLMIHYRAGIEDIETLESLSLDQHSKKISKYT   1051 - 1120
DDTEEDLDNEISQLIDSQPFSSISDDLFGPSESV                                       1121 - 1154
//

Text Mined References (19)

PMID Year Title