Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.75
PubTator Score 4.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.55206785160065E-6
ovarian cancer 8492 3.5636467474697E-5
adult high grade glioma 2148 1.83503473801329E-4
psoriasis 6685 0.00148431390770825
group 4 medulloblastoma 1875 0.00178779548973134
medulloblastoma, large-cell 6234 0.0023511313215165
lung cancer 4473 0.00336487916931447
tuberculosis and treatment for 6 months 686 0.00849205722092585
spina bifida 1064 0.0226439600247717
colon cancer 1475 0.0308999534412093
non primary Sjogren syndrome sicca 840 0.0384301461632818
Breast cancer 3099 0.039029952909679
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0447220268159417
Disease Target Count Z-score Confidence
post-traumatic stress disorder 45 3.224 1.6

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.300 0.001
osteosarcoma -2.754 0.000
group 4 medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.200 0.002
pancreatic ductal adenocarcinoma liver m... -2.102 0.045
tuberculosis and treatment for 6 months 1.200 0.008
colon cancer 1.700 0.031
lung cancer 1.700 0.003
Breast cancer 2.000 0.039
adult high grade glioma -1.400 0.000
non primary Sjogren syndrome sicca 1.200 0.038
spina bifida -1.009 0.023
ovarian cancer -1.600 0.000

Synonym

Accession Q8NEN9 Q86WE0 Q86WE5 Q9UFF1
Symbols PDZK8

Gene

  Ortholog (15)

Gene RIF (8)

PMID Text
25771112 PDZD8 is not absolutely necessary for HIV-1 infection.
25036886 The putative coiled-coil motif (residues 1017-1063) of PDZD8 is both necessary and sufficient for HIV-1 CA-NC binding and the PDZ domain (residues 366-450) contributes to the function of PDZD8 as an HIV-1 cofactor for infectivity
24554657 The PDZD8 coiled-coil domain is sufficient for HIV-1 capsid binding, but other parts of the protein, including the PDZ domain, are apparently required for stabilizing the capsid and supporting HIV-1 infection.
24554657 The putative coiled-coil motif (residues 1017-1063) of PDZD8 is both necessary and sufficient for HIV-1 CA-NC binding and the PDZ domain (residues 366-450) contributes to the function of PDZD8 as an HIV-1 cofactor for infectivity
21549406 PDZD8 is a novel moesin-interacting protein that suppresses infection by herpes simplex virus type 1.
20573829 A mutant of PDZD8 lacking the coiled-coil domain in its Gag-interacting region failed to bind Gag and promote HIV-1 infection.
20573829 The putative coiled-coil motif (residues 1017-1063) of PDZD8 is both necessary and sufficient for HIV-1 CA-NC binding and the PDZ domain (residues 366-450) contributes to the function of PDZD8 as an HIV-1 cofactor for infectivity
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLLLMILASAVLGSFLTLLAQFFLLYRRQPEPPADEAARAGEGFRYIKPVPGLLLREYLYGGGRDEEPS      1 - 70
GAAPEGGATPTAAPETPAPPTRETCYFLNATILFLFRELRDTALTRRWVTKKIKVEFEELLQTKTAGRLL     71 - 140
EGLSLRDVFLGETVPFIKTIRLVRPVVPSATGEPDGPEGEALPAACPEELAFEAEVEYNGGFHLAIDVDL    141 - 210
VFGKSAYLFVKLSRVVGRLRLVFTRVPFTHWFFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIK    211 - 280
RKHTLPNYKIRFKPFFPYQTLQGFEEDEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLE    281 - 350
LSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDRLIAIG    351 - 420
GVKITSTLQVLKLIKQAGDRVLVYYERPVGQSNQGAVLQDNFGQLEENFLSSSCQSGYEEEAAGLTVDTE    421 - 490
SRELDSEFEDLASDVRAQNEFKDEAQSLSHSPKRVPTTLSIKPLGAISPVLNRKLAVGSHPLPPKIQSKD    491 - 560
GNKPPPLKTSEITDPAQVSKPTQGSAFKPPVPPRPQAKVPLPSADAPNQAEPDVLVEKPEKVVPPPLVDK    561 - 630
SAEKQAKNVDAIDDAAAPKQFLAKQEVAKDVTSETSCPTKDSSDDRQTWESSEILYRNKLGKWTRTRASC    631 - 700
LFDIEACHRYLNIALWCRDPFKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTA    701 - 770
LRNLSMQKGFNDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENK    771 - 840
HSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETSVCGATDRRIDRTLKNLRLEGQ    841 - 910
ETLLGLPPRVDAEASKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGS    911 - 980
DTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQE    981 - 1050
LEHNNSLVREEKETTDTRKKSLLSAALAKSGERLQALTLLMIHYRAGIEDIETLESLSLDQHSKKISKYT   1051 - 1120
DDTEEDLDNEISQLIDSQPFSSISDDLFGPSESV                                       1121 - 1154
//

Text Mined References (18)

PMID Year Title
25771112 2015 Efficient human immunodeficiency virus (HIV-1) infection of cells lacking PDZD8.
24554657 2014 Contribution of PDZD8 to stabilization of the human immunodeficiency virus type 1 capsid.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22683750 2012 A meta-analysis of genome-wide association studies of the electrocardiographic early repolarization pattern.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21549406 2011 PDZD8 is a novel moesin-interacting cytoskeletal regulatory protein that suppresses infection by herpes simplex virus type 1.
20573829 2010 PDZD8 is a novel Gag-interacting factor that promotes retroviral infection.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...