Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.91
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.52180671055456E-12
nasopharyngeal carcinoma 1056 5.30883041787891E-6
osteosarcoma 7933 7.54788812041172E-6
chronic rhinosinusitis 512 0.0179797812684426
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0
Prostate cancer 172 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.178 0.000
posterior fossa group B ependymoma 3.000 0.000
nasopharyngeal carcinoma -1.400 0.000
chronic rhinosinusitis -1.772 0.018

Synonym

Accession Q8NEN0 A8K8Y4 B4DGF5 G5E993 Q5VVY8 Q9H0K9
Symbols bA787I22.1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid
Fruitfly EggNOG Inparanoid

 Compartment GO Term (2)

Gene RIF (2)

PMID Text
20080650 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSPNDKMLGKLDPFYQPSVSKQKTSAEIISEARNALRTVRTQRPFTPQEAQRKLFGPASSRTSENRPPS      1 - 70
SFSLHASSFESSDSRPISGTRLSPLELKPKVPASPTREEDSCFSFPKPPVDPAKIRRVSNARARLFRAAS     71 - 140
QRALLPDRSLPPSDSKKTVESKETVMMGDSMVKINGIYLTKSNAICHLKSHPLQLTDDGGFSEIKEQEMF    141 - 210
KGTTSLPSHLKNGGDQGKRHARASSCPSSSDLSRLQTKAVPKADLQEEDAEIEVDEVFWNTRIVPILREL    211 - 280
EKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLSLKLAKIILALKVSRKNLL    281 - 350
NVCKLIFKISRNEKNDSLIQNDSILESLLEVLRSEDLQTNMEAFLYCMGSIKFISGNLGFLNEMISKGAV    351 - 420
EILINLIKQINENIKKCGTFLPNSGHLLVQVTATLRNLVDSSLVRSKFLNISALPQLCTAMEQYKGDKDV    421 - 490
CTNIARIFSKLTSYRDCCTALASYSRCYALFLNLINKYQKKQDLVVRVVFILGNLTAKNNQAREQFSKEK    491 - 560
GSIQTLLSLFQTFHQLDLHSQKPVGQRGEQHRAQRPPSEAEDVLIKLTRVLANIAIHPGVGPVLAANPGI    561 - 630
VGLLLTTLEYKSLDDCEELVINATATINNLSYYQVKNSIIQDKKLYIAELLLKLLVSNNMDGILEAVRVF    631 - 700
GNLSQDHDVCDFIVQNNVHRFMMALLDAQHQDICFSACGVLLNLTVDKDKRVILKEGGGIKKLVDCLRDL    701 - 770
GPTDWQLACLVCKTLWNFSENITNASSCFGNEDTNTLLLLLSSFLDEELALDGSFDPDLKNYHKLHWETE    771 - 840
FKPVAQQLLNRIQRHHTFLEPLPIPSF                                               841 - 867
//

Text Mined References (15)

PMID Year Title
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...