Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.81
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 5.4e-09
nasopharyngeal carcinoma 1058 5.3e-06
osteosarcoma 7950 7.5e-06
chronic rhinosinusitis 512 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 3.0
Prostate cancer 175 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -1.772 1.8e-02
ependymoma 2.100 5.4e-09
nasopharyngeal carcinoma -1.400 5.3e-06
osteosarcoma -1.178 7.5e-06

Synonym

Accession Q8NEN0 A8K8Y4 B4DGF5 G5E993 Q5VVY8 Q9H0K9
Symbols bA787I22.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MLSPNDKMLGKLDPFYQPSVSKQKTSAEIISEARNALRTVRTQRPFTPQEAQRKLFGPASSRTSENRPPS      1 - 70
SFSLHASSFESSDSRPISGTRLSPLELKPKVPASPTREEDSCFSFPKPPVDPAKIRRVSNARARLFRAAS     71 - 140
QRALLPDRSLPPSDSKKTVESKETVMMGDSMVKINGIYLTKSNAICHLKSHPLQLTDDGGFSEIKEQEMF    141 - 210
KGTTSLPSHLKNGGDQGKRHARASSCPSSSDLSRLQTKAVPKADLQEEDAEIEVDEVFWNTRIVPILREL    211 - 280
EKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLSLKLAKIILALKVSRKNLL    281 - 350
NVCKLIFKISRNEKNDSLIQNDSILESLLEVLRSEDLQTNMEAFLYCMGSIKFISGNLGFLNEMISKGAV    351 - 420
EILINLIKQINENIKKCGTFLPNSGHLLVQVTATLRNLVDSSLVRSKFLNISALPQLCTAMEQYKGDKDV    421 - 490
CTNIARIFSKLTSYRDCCTALASYSRCYALFLNLINKYQKKQDLVVRVVFILGNLTAKNNQAREQFSKEK    491 - 560
GSIQTLLSLFQTFHQLDLHSQKPVGQRGEQHRAQRPPSEAEDVLIKLTRVLANIAIHPGVGPVLAANPGI    561 - 630
VGLLLTTLEYKSLDDCEELVINATATINNLSYYQVKNSIIQDKKLYIAELLLKLLVSNNMDGILEAVRVF    631 - 700
GNLSQDHDVCDFIVQNNVHRFMMALLDAQHQDICFSACGVLLNLTVDKDKRVILKEGGGIKKLVDCLRDL    701 - 770
GPTDWQLACLVCKTLWNFSENITNASSCFGNEDTNTLLLLLSSFLDEELALDGSFDPDLKNYHKLHWETE    771 - 840
FKPVAQQLLNRIQRHHTFLEPLPIPSF                                               841 - 867
//

Text Mined References (15)

PMID Year Title