Property Summary

NCBI Gene PubMed Count 19
PubMed Score 73.62
PubTator Score 23.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
group 3 medulloblastoma 1.500 3.7e-04
intraductal papillary-mucinous adenoma (... 1.400 6.4e-05
intraductal papillary-mucinous carcinoma... 1.100 3.5e-03
juvenile dermatomyositis 1.082 6.7e-12
malignant mesothelioma 1.200 3.2e-05
ovarian cancer -1.700 1.5e-09
pancreatic cancer 1.100 8.4e-03
Pick disease -1.200 1.2e-05
primary pancreatic ductal adenocarcinoma 1.039 3.5e-02
primitive neuroectodermal tumor 1.100 7.7e-04
progressive supranuclear palsy -1.100 5.6e-03
psoriasis -1.600 5.0e-05
tuberculosis -1.200 1.5e-03

 GO Process (2)

Gene RIF (7)

AA Sequence

MQQALELALDRAEYVIESARQRPPKRKYLSSGRKSVFQKLYDLYIEECEKEPEVKKLRRNVNLLEKLVMQ      1 - 70
ETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGC     71 - 140
VIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQEDKLLLESQLILATAEPLCLD    141 - 210
PSIAVTCTANRLLYNKQKMNTRPMKRCFKRYSRSSLNRQQDLSHCPPPPQLRLLDFLQKRKERKAGQHYD    211 - 280
LKISKAGNCVDMWKRSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKT    281 - 350
KLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDDHSNWFIIGSKTDAERVVNQYQELVQNEAKCP    351 - 420
VKMSHSSSGSASLSQVSPGKETDQTETVSVQSSVLGKGVKHRPPPIKLPSSSGNSSSGNYFTPQQTSSFL    421 - 490
KSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMANSAGLNFINVVGSVCGAQALM    491 - 560
SGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSL    561 - 630
IFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAV    631 - 700
LSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMK    701 - 770
RGTPTTPKF                                                                 771 - 779
//

Text Mined References (22)

PMID Year Title