Property Summary

NCBI Gene PubMed Count 19
PubMed Score 73.62
PubTator Score 23.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
group 3 medulloblastoma 1.500 3.7e-04
intraductal papillary-mucinous adenoma (... 1.400 6.4e-05
intraductal papillary-mucinous carcinoma... 1.100 3.5e-03
juvenile dermatomyositis 1.082 6.7e-12
malignant mesothelioma 1.200 3.2e-05
ovarian cancer -1.700 1.5e-09
pancreatic cancer 1.100 8.4e-03
Pick disease -1.200 1.2e-05
primary pancreatic ductal adenocarcinoma 1.039 3.5e-02
primitive neuroectodermal tumor 1.100 7.7e-04
progressive supranuclear palsy -1.100 5.6e-03
psoriasis -1.600 5.0e-05
tuberculosis -1.200 1.5e-03

Synonym

Accession Q8NEM7 E7ER46 Q71RF3 Q9Y6A6
Symbols C13
FP757
P38IP
SPT20
FAM48A
C13orf19

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (2)

Gene RIF (7)

AA Sequence

MQQALELALDRAEYVIESARQRPPKRKYLSSGRKSVFQKLYDLYIEECEKEPEVKKLRRNVNLLEKLVMQ      1 - 70
ETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGC     71 - 140
VIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQEDKLLLESQLILATAEPLCLD    141 - 210
PSIAVTCTANRLLYNKQKMNTRPMKRCFKRYSRSSLNRQQDLSHCPPPPQLRLLDFLQKRKERKAGQHYD    211 - 280
LKISKAGNCVDMWKRSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKT    281 - 350
KLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDDHSNWFIIGSKTDAERVVNQYQELVQNEAKCP    351 - 420
VKMSHSSSGSASLSQVSPGKETDQTETVSVQSSVLGKGVKHRPPPIKLPSSSGNSSSGNYFTPQQTSSFL    421 - 490
KSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMANSAGLNFINVVGSVCGAQALM    491 - 560
SGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSL    561 - 630
IFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAV    631 - 700
LSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMK    701 - 770
RGTPTTPKF                                                                 771 - 779
//

Text Mined References (22)

PMID Year Title