Property Summary

NCBI Gene PubMed Count 19
Grant Count 3
Funding $100,037
PubMed Score 5.78
PubTator Score 9.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NEM2 Q96N60 Q9BVS0 Q9H6P6
Symbols PAL

Gene

Gene RIF (4)

PMID Text
25486361 This study gives novel insight into the role of SHCBP in cytokinesis completion.
24289556 Knockdown of SHCBP1 induced cell cycle delay.
23804634 The central region of SHCBP1 was found to bind to measles virus C protein, as well as the phosphoprotein, but the two viral proteins did not compete for SHCBP1 binding.
18976975 Knockdown of SHC SH2-domain binding protein 1 (SHCBP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MADGSLTGGGLEAAAMAPERMGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFMPEGKTFFPEI      1 - 70
FQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWHTNVFKVLVEITDVDFAALKA     71 - 140
VVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWVVFDDSGVFDQTALAIEHVRFFYQNIWRSWD    141 - 210
EEEEDEYDYFVRCVEPRLRLHYDILEDRVPSGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENI    211 - 280
SMVEGLKLYSEMEQLKQKLKLIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTD    281 - 350
RLCQEPGEEEREIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKG    351 - 420
DTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGA    421 - 490
GIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAE    491 - 560
DGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKK    561 - 630
KRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF                                631 - 672
//

Text Mined References (29)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25486361 2014 SHCBP1 is required for midbody organization and cytokinesis completion.
24289556 2013 Targeting SHCBP1 inhibits cell proliferation in human hepatocellular carcinoma cells.
23804634 2013 Measles virus nonstructural C protein modulates viral RNA polymerase activity by interacting with host protein SHCBP1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21187330 2010 Nessun Dorma, a novel centralspindlin partner, is required for cytokinesis in Drosophila spermatocytes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...