Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.73
PubTator Score 9.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 2.652 4.8e-05
adult high grade glioma 2.300 2.1e-05
Astrocytoma, Pilocytic 1.300 1.4e-04
Atopic dermatitis 1.100 2.4e-02
atypical teratoid / rhabdoid tumor 1.900 4.0e-04
Breast cancer 1.300 1.9e-06
colon cancer 1.100 3.4e-02
ductal carcinoma in situ 1.200 2.3e-03
Endometriosis 1.105 2.7e-02
glioblastoma 2.700 1.3e-10
group 3 medulloblastoma 1.600 1.9e-03
intraductal papillary-mucinous neoplasm ... 1.600 4.7e-04
invasive ductal carcinoma 1.500 3.1e-03
medulloblastoma, large-cell 1.700 1.7e-03
non-small cell lung cancer 1.866 4.5e-25
ovarian cancer 1.100 7.2e-03
pancreatic cancer 1.300 1.4e-02
pancreatic carcinoma 1.300 1.4e-02
posterior fossa group A ependymoma 1.600 8.5e-06
primitive neuroectodermal tumor 2.000 2.4e-03
psoriasis 1.300 1.1e-03
ulcerative colitis 2.200 5.8e-07

Gene RIF (5)

AA Sequence

MADGSLTGGGLEAAAMAPERMGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFMPEGKTFFPEI      1 - 70
FQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWHTNVFKVLVEITDVDFAALKA     71 - 140
VVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWVVFDDSGVFDQTALAIEHVRFFYQNIWRSWD    141 - 210
EEEEDEYDYFVRCVEPRLRLHYDILEDRVPSGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENI    211 - 280
SMVEGLKLYSEMEQLKQKLKLIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTD    281 - 350
RLCQEPGEEEREIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKG    351 - 420
DTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGA    421 - 490
GIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAE    491 - 560
DGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKK    561 - 630
KRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF                                631 - 672
//

Text Mined References (30)

PMID Year Title