Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.78
PubTator Score 9.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.94936771760009E-138
non-small cell lung cancer 2798 4.49640888879161E-25
glioblastoma 5572 1.34441316753915E-10
ulcerative colitis 2087 5.79967671497347E-7
pediatric high grade glioma 2712 5.95964009826681E-7
atypical teratoid/rhabdoid tumor 1095 1.5259648669368E-6
Breast cancer 3099 1.90311581209657E-6
posterior fossa group A ependymoma 1511 8.49386953425395E-6
sonic hedgehog group medulloblastoma 1482 1.42655789728643E-5
adrenocortical carcinoma 1427 4.80425351523857E-5
pilocytic astrocytoma 3086 1.43324067344012E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 4.71037595965526E-4
medulloblastoma, large-cell 6234 0.00166972959168914
ductal carcinoma in situ 1745 0.00232765932935854
primitive neuroectodermal tumor 3031 0.00237492254503369
invasive ductal carcinoma 2950 0.00312079323620663
ovarian cancer 8492 0.00718821049106603
pancreatic cancer 2300 0.014179283978281
pancreatic carcinoma 567 0.014179283978281
Atopic dermatitis 944 0.0242633453297747
Endometriosis 535 0.0269117141365469
colon cancer 1475 0.0340661683400187

Expression

Synonym

Accession Q8NEM2 Q96N60 Q9BVS0 Q9H6P6
Symbols PAL

Gene

  Ortholog (10)

Gene RIF (4)

PMID Text
25486361 This study gives novel insight into the role of SHCBP in cytokinesis completion.
24289556 Knockdown of SHCBP1 induced cell cycle delay.
23804634 The central region of SHCBP1 was found to bind to measles virus C protein, as well as the phosphoprotein, but the two viral proteins did not compete for SHCBP1 binding.
18976975 Knockdown of SHC SH2-domain binding protein 1 (SHCBP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MADGSLTGGGLEAAAMAPERMGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFMPEGKTFFPEI      1 - 70
FQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWHTNVFKVLVEITDVDFAALKA     71 - 140
VVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWVVFDDSGVFDQTALAIEHVRFFYQNIWRSWD    141 - 210
EEEEDEYDYFVRCVEPRLRLHYDILEDRVPSGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENI    211 - 280
SMVEGLKLYSEMEQLKQKLKLIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTD    281 - 350
RLCQEPGEEEREIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKG    351 - 420
DTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGA    421 - 490
GIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAE    491 - 560
DGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKK    561 - 630
KRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF                                631 - 672
//

Text Mined References (29)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25486361 2014 SHCBP1 is required for midbody organization and cytokinesis completion.
24289556 2013 Targeting SHCBP1 inhibits cell proliferation in human hepatocellular carcinoma cells.
23804634 2013 Measles virus nonstructural C protein modulates viral RNA polymerase activity by interacting with host protein SHCBP1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21187330 2010 Nessun Dorma, a novel centralspindlin partner, is required for cytokinesis in Drosophila spermatocytes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...