Property Summary

NCBI Gene PubMed Count 110
PubMed Score 109.32
PubTator Score 96.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 3.9e-02
atypical teratoid/rhabdoid tumor 1.100 3.9e-05
glioblastoma 1.100 3.1e-05
group 3 medulloblastoma 1.200 2.4e-03
lung cancer 1.500 1.1e-03
medulloblastoma, large-cell 1.200 2.7e-04
osteosarcoma -1.802 3.9e-06
ovarian cancer -1.300 4.4e-04
primitive neuroectodermal tumor 1.100 1.2e-02

Gene RIF (72)

AA Sequence

MAAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKL      1 - 70
VSVLWVEKCRTAGAHIDESLFPAANMNEHLSSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQR     71 - 140
QKTNLDDDVPILLFESNGSLIYTPTIEINSRHHSAMEKRLQEMKEKRENLSPTSSQMIQQSHDNPSNSLC    141 - 210
EAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERKLEGSINDIKSDVCISSLVLKANNIHSSPSF    211 - 280
THLDKSSPQKFLSNLSKEEINLQRNIAGKVVTPDQKQAAGMSQETFEEKYRLSPTLSSTKGHLLIHSRPR    281 - 350
SSSVKRKRVSHGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSYDDYFSPDN    351 - 420
LKERYSENLPPESQLPSSPAQLSCRSLSKKERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNG    421 - 490
EGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDDDLTPLEGSLEEMKEAVGLKS    491 - 560
TQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDL    561 - 630
IKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLG    631 - 700
IARGCWVLSYDWVLWSLELGHWISEEPFELSHHFPAAPLCRSECHLSAGPYRGTLFADQPAMFVSPASSP    701 - 770
PVAKLCELVHLCGGRVSQVPRQASIVIGPYSGKKKATVKYLSEKWVLDSITQHKVCAPENYLLSQ         771 - 835
//

Text Mined References (113)

PMID Year Title