Property Summary

NCBI Gene PubMed Count 3
PubMed Score 51.44
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.018 1.5

Expression

Gene RIF (1)

AA Sequence

MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTSDDCNQDDDSYDGKMNLPVVL      1 - 70
QDVKTAQVELFSQMTDIVHMIPKVQEKTDLYQKQMEVLETRMNVNEDKQCTTTKDILSMKEDIKALKKKV     71 - 140
TELEIQNSCSTIHCLEILEGERGKEITELLYKLIQPATLKNTLASTDMEISSAEPEKVPSYPKSTDHLEK    141 - 210
KTISPQMKTLKKRNHQNASRSFEKAKPNIYIYPDFSTWIKLTFVHGGKWTFFLSATKLEEFIQWLLSRPT    211 - 280
ILPEEPQVITQRYCPFTGPILSLTTICLSIFNNIYGFICSLKEEVTRL                          281 - 328
//

Text Mined References (6)

PMID Year Title