Property Summary

NCBI Gene PubMed Count 3
Grant Count 18
R01 Count 6
Funding $2,436,632.56
PubMed Score 48.47
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
16138340 data supporting the rationale for further investigations of Sp17 for tumor vaccines in testicular cancer. (review)

AA Sequence

MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTSDDCNQDDDSYDGKMNLPVVL      1 - 70
QDVKTAQVELFSQMTDIVHMIPKVQEKTDLYQKQMEVLETRMNVNEDKQCTTTKDILSMKEDIKALKKKV     71 - 140
TELEIQNSCSTIHCLEILEGERGKEITELLYKLIQPATLKNTLASTDMEISSAEPEKVPSYPKSTDHLEK    141 - 210
KTISPQMKTLKKRNHQNASRSFEKAKPNIYIYPDFSTWIKLTFVHGGKWTFFLSATKLEEFIQWLLSRPT    211 - 280
ILPEEPQVITQRYCPFTGPILSLTTICLSIFNNIYGFICSLKEEVTRL                          281 - 328
//

Text Mined References (6)

PMID Year Title
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16138340 2005 Cancer immunotherapy targeting Sp17: when should the laboratory findings be translated to the clinics?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15257753 2004 Association of sperm protein 17 with A-kinase anchoring protein 3 in flagella.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.