Property Summary

NCBI Gene PubMed Count 7
PubMed Score 13.93
PubTator Score 5.25

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession Q8NEK8 B2R9Q6 Q7Z3F6 Q8NHU1
Symbols CT112
CT1.26

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
19540335 Overexpression of FAM46D is associated with neoplasms.

AA Sequence

MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASY      1 - 70
ILASHNGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNG     71 - 140
HDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGD    141 - 210
FQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKI    211 - 280
ESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQ    281 - 350
PAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGMS                                   351 - 389
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19540335 2009 Identification of FAM46D as a novel cancer/testis antigen using EST data and serological analysis.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.