Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.47
PubTator Score 7.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.500 2.1e-02
intraductal papillary-mucinous neoplasm ... 1.200 9.4e-03
osteosarcoma 1.023 4.2e-05

Gene RIF (3)

AA Sequence

MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVP      1 - 70
VADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPI     71 - 140
IRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL                          141 - 188
//

Text Mined References (10)

PMID Year Title