Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
R01 Count 4
Funding $388,513.67
PubMed Score 5.47
PubTator Score 7.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.500 0.021
osteosarcoma -1.331 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.009

Synonym

Accession Q8NEJ0 B3KPA4
Symbols DSP18
DUSP20
LMWDSP20

Gene

PDB

2ESB  

Gene RIF (3)

PMID Text
16720344 DUSP18 appears to serve an important role by regulation of SAPK/JNK pathway
16699184 The crystal structure of human DSP18 (official symbol DUSP18) has been determined at 2.0 A resolution.
12591617 molecular cloning, base sequence and amino acid sequence

AA Sequence

MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVP      1 - 70
VADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPI     71 - 140
IRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL                          141 - 188
//

Text Mined References (10)

PMID Year Title
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
19228121 2009 Dual-specificity phosphatases: critical regulators with diverse cellular targets.
16720344 2006 Dual specificity phosphotase 18, interacting with SAPK, dephosphorylates SAPK and inhibits SAPK/JNK signal pathway in vivo.
16699184 2006 Structure of human DSP18, a member of the dual-specificity protein tyrosine phosphatase family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12591617 2003 Molecular cloning and characterization of a novel dual-specificity phosphatase18 gene from human fetal brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408986 2002 Identification and characterization of two novel low-molecular-weight dual specificity phosphatases.