Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.27
PubTator Score 0.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 6.000 0.000
glioblastoma 1.200 0.040
atypical teratoid / rhabdoid tumor 1.400 0.029
nasopharyngeal carcinoma -3.400 0.000
psoriasis 2.500 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19193627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MRNTSKELQGATHRYAPCDWYYHVPVKRSEKAVDAPPASQIPGLSNLGDSHSENLPGTRRYWIKETDSEY      1 - 70
VKLAKQGGRPDLLKHFAPGTRKGSPVAYSLPDWYIHHSKPPTASQQEVRAVSMPDYMVHEEFNPDQANGS     71 - 140
YASRRGPFDFDMKTVWQREAEELEKEKKKLRLPAIDSKYLSKAGTPLGPKNPAGSRLSFPPVPGQKNSSP    141 - 210
TNFSKLISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPESSQ    211 - 280
SPEESVSASTPAELK                                                           281 - 295
//

Text Mined References (5)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19193627 2009 A two-stage genome-wide association study of sporadic amyotrophic lateral sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.