Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.12
PubTator Score 10.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 1.3e-06
diabetes mellitus -1.100 1.1e-03
glioblastoma 1.100 3.1e-05
osteosarcoma 1.270 2.4e-02
pediatric high grade glioma 1.200 6.2e-07

 GO Function (1)

Gene RIF (5)

AA Sequence

MAQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTEDALLKNQRRAQRLLEEIHAMKELKP      1 - 70
DIVTKSALGDDINFEKIFKKPDSTATERAIARLAVHPLLKKKIDVLKAAVQAFKEARQNVAEVESSKNAS     71 - 140
EDNHSENTLYSNDNGSNLQREATVISEQKVKETKILAKKPIHNSKEKIAKMEHGPKAVTIANSPSKPSEK    141 - 210
DSVVSLESQKTPADPKLKTLSQTKKNKGSDSSLSGNSDGGEEFCEEEKEYFDDSTEERFYKQSSMSEDSD    211 - 280
SGDDFFIGKVRRTRKKESSCHSSVKEQKPLEKVFLKEDTGETHGDTRNDKIKPSTETRKLESVFFHSLSG    281 - 350
SKSSRRNFKEQAPKTRSLDFPQNEPQIKNQFNKKLSGRLENTKQQLQLPLHPSWEASRRRKEQQSNIAVF    351 - 420
QGKKITFDD                                                                 421 - 429
//

Text Mined References (23)

PMID Year Title