Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 5.06243995137542E-6


  Differential Expression (1)

Disease log2 FC p
tuberculosis 1.700 0.000

AA Sequence

MSSTSSKAESTWGPSPSLSKTEVDQDLTYYEAV                                         841 - 873

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.