Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 5.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis 1.700 5.1e-06

AA Sequence

MTDSDEDALKVDQGPSRDIPKPWVIPAPKGILQHIFGTSHVFQSICDVKPKVTGLTVPLKVREYYSRGQQ      1 - 70
CLEQADWETAVLLFSRALHLDPQLVDFYALRAEAYLQLCDFSSAAQNLRRAYSLQQDNCKHLERLTFVLY     71 - 140
LQGQCLFEQCAFLDALNVFSHAAELQPEKPCFRYRCMACLLALKQHQACLTLITNELKQDTTNADVYIFR    141 - 210
ARLYNFLQKPHLCYRDLHSALLLNPKHPQARMLLQKMVAQAQQARQDAGILAVQGKLQHALQRINRAIEN    211 - 280
NPLDPSLFLFRGTMYRRLQEFDGAVEDFLKVLDMVTEDQEDMVRQAQRQLLLTYNDFAVHCYRQGAYQEG    281 - 350
VLLLNKALRDEQQEKGLYINRGDCFFQLGNLAFAEADYQQALALSPQDEGANTRMGLLQEKMGFCEQRRK    351 - 420
QFQKAENHFSTAIRHNPQKAQYYLYRAKSRQLLQNIFGARQDVATVLLLNPKQPKLSLLMTNLFPGMSVE    421 - 490
EVLSTQIAHLARLQLEQMVEGSLQAGSPQGIVGMLKRHELERQKALALQHSWKQGEPLIATSEELKATPE    491 - 560
IPQVKPGSSEGEAEAPEEEEEKEKEKKEEKKSELIPSKVASLSDSYLDQTSSASSMSFRTTGTSETEMSA    561 - 630
ICQEYRSTSATAVTFSDSSLLKTQSSDSGNNREALSHGPRKIKATQGQRQSLSKTEPTQSQRRNSSKTKA    631 - 700
TIHKRNSSKTKATQSQRRNSSKTRATQGQGQSSSKTEATQGQRQSSSEIEATQGPRQEPSKTKTTRSPRQ    701 - 770
RPRKVKAARGRSWRPSKVDATQGRSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQG    771 - 840
MSSTSSKAESTWGPSPSLSKTEVDQDLTYYEAV                                         841 - 873
//

Text Mined References (4)

PMID Year Title