Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.9e-09

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 2.061 3.9e-09

Synonym

Accession Q8NEE0
Symbols C2orf19

 Compartment GO Term (0)

AA Sequence

MCLRSHFKVAFTQRKVELSKELRRSRSSRNGGLPLQEQPMGQKWGWHRGEPGHPRMEELNEWPQNGDHWS      1 - 70
RKWPPPCAFTPG                                                               71 - 82
//

Text Mined References (3)

PMID Year Title