Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.65
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 3.393 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 1.100 6.7e-04
group 3 medulloblastoma 1.200 1.5e-03
invasive ductal carcinoma 1.100 5.4e-03
lung cancer -1.300 1.5e-04
medulloblastoma, large-cell 1.500 3.3e-04
osteosarcoma 1.595 1.3e-04
ovarian cancer -1.300 2.9e-05
pituitary cancer 1.500 6.6e-10

Synonym

Accession Q8NEC7 A8K8J0 A8MVD3 H9KV97 Q9H8S3
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MKAIKKSLTEEEYLYLDFSHQTEGCIFPLHTSVTLFLLSYCDCKIFKICLVVTKEVSRDSSLLRDDLIQD      1 - 70
VEIQIISRQELPPIVQNCCLPAVVERSDNFCRAGLAVVLRHIIQKSYEADPLKKELLELLGFKKTCLKAC     71 - 140
AEVSQWTRLCELTIPLAIENFLRESSDQPPTIPVEILQLEKKLSEPVRVHNDDKLRRQKLKQQKADGVGP    141 - 210
PLTKGKAKSKVHTQETSEGLDSSSKSLELKVAFSKLTVQEEPATTNREPSHIRKAKASDLPPLEHVFAEG    211 - 280
LYFTLADIVLLPCIHHFLVIISRKFSEKLVEFPLLASWYQRIQEVPGVKTAASKCGIQFLHLPKLLTTST    281 - 350
EQHPNLCEVPGVEEQSDPLFIGGPRPTMAKLMEKGIEVMFSPHPCPTWTLDWNVLPAAVSPKEGKMSSDR    351 - 420
ALRKQQQLNNLVYVVTNQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGL    421 - 490
SNIWFIQANMEYFTGMFNIGVALHACGVATDMVIEHCIKTRASFVTCPCCYGFIQNTSKFNFPKSEQFKK    491 - 560
TLSYKEHMILCRFADQTAVQLPPQRRLIGKQCMCLVDLDRARAAEECGYSVQVISMEPESCSPKNNMIVG    561 - 630
VPI                                                                       631 - 633
//

Text Mined References (17)

PMID Year Title