Property Summary

NCBI Gene PubMed Count 27
Grant Count 18
R01 Count 11
Funding $1,795,797.33
PubMed Score 12.98
PubTator Score 48.95

Knowledge Summary

Patent (3,809)

Expression

Gene RIF (18)

PMID Text
26453676 Sperm with a near absence of CatSper current failed to respond to activation of CatSper by progesterone and there was fertilization failure at IVF.
26354096 The role of CATSPER1 in idiopathic asthenospermia pathogenesis: exonal SNP rs1893316 in CATSPER1 significantly correlated with idiopathic asthenospermia risk
25101494 Sox5 and Sox9 cause a significant increase in transactivation of the Catsper1 promoter.
23623968 Progesterone via CatSper activates the PI3K-AKT pathway required for motility and hyperactivation but not for acrosome reaction.
23530196 CatSper is indeed the principal Ca2+ channel of human spermatozoa, and that it is strongly potentiated by progesterone.
23344959 CatSper activation can elicit functionally different behaviors according to the sensitivity of the Ca(2+) store, which may be regulated by capacitation and NO from the cumulus.
23313885 The immediate upstream region and the first exon in the human CATSPER1 gene negatively regulate transcriptional activity.
23313885 This work reports the cloning and characterization of the promoter regions in the human and murine Catsper1 genes. The immediate upstream region and the first exon in the human CATSPER1 gene negatively regulate transcriptional activity. The mouse Catsper1 promoter exhibited transcriptional activity in both orientations and displayed significant expression levels in mouse testis in vivo.
22354039 It was shown that odorants directly activate CatSper without involving G protein-coupled receptors and cAMP. Membrane-permeable analogues of cyclic nucleotides activated CatSper directly via an extracellular site.
21412339 human CatSper is synergistically activated by elevation of intracellular pH and extracellular progesterone
More...

AA Sequence

MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHPPEFQDFHDQA      1 - 70
LSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQRDGRRHHDGSQYGGFHQQSD     71 - 140
SHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYLPHGPNPYSESFHHSEASHLSGLQHDESQHH    141 - 210
QVPHRGWPHHHQVHHHGRSRHHEAHQHGKSPHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHG    211 - 280
DHPHHTQHHYHQTHRHRDYHQHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFP    281 - 350
YHVAHPRGSAHSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRKTGRLQRTRKKGHSTN    351 - 420
LFQWLWEKLTFLIQGFREMIRNLTQSLAFETFIFFVVCLNTVMLVAQTFAEVEIRGEWYFMALDSIFFCI    421 - 490
YVVEALLKIIALGLSYFFDFWNNLDFFIMAMAVLDFLLMQTHSFAIYHQSLFRILKVFKSLRALRAIRVL    491 - 560
RRLSFLTSVQEVTGTLGQSLPSIAAILILMFTCLFLFSAVLRALFRKSDPKRFQNIFTTIFTLFTLLTLD    561 - 630
DWSLIYMDSRAQGAWYIIPILVIYIIIQYFIFLNLVITVLVDSFQTALFKGLEKAKQERAARIQEKLLED    631 - 700
SLTELRAAEPKEVASEGTMLKRLIEKKFGTMTEKQQELLFHYLQLVASVEQEQQKFRSQAAVIDEIVDTT    701 - 770
FEAGEEDFRN                                                                771 - 780
//

Text Mined References (30)

PMID Year Title
26989199 2016 Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone.
26453676 2015 Specific loss of CatSper function is sufficient to compromise fertilizing capacity of human spermatozoa.
26354096 2015 Analysis of the correlation of CATSPER single nucleotide polymorphisms (SNPs) with idiopathic asthenospermia.
25416956 2014 A proteome-scale map of the human interactome network.
25101494 2014 The transcription factors Sox5 and Sox9 regulate Catsper1 gene expression.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23623968 2013 Progesterone utilizes the PI3K-AKT pathway in human spermatozoa to regulate motility and hyperactivation but not acrosome reaction.
23530196 2013 Disruption of the principal, progesterone-activated sperm Ca2+ channel in a CatSper2-deficient infertile patient.
23344959 2013 Ca2+ signals generated by CatSper and Ca2+ stores regulate different behaviors in human sperm.
23313885 2013 Molecular cloning and analysis of the Catsper1 gene promoter.
More...