Property Summary

NCBI Gene PubMed Count 89
Grant Count 111
R01 Count 83
Funding $7,262,999.63
PubMed Score 181.78
PubTator Score 128.38

Knowledge Summary

Patent (9,028)

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma 1.812 0.000
glioblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -2.200 0.000
colon cancer -2.600 0.012
lung cancer 1.100 0.010
adult high grade glioma -1.700 0.000
posterior fossa group B ependymoma 1.500 0.000
lung adenocarcinoma -1.100 0.000
Breast cancer -1.100 0.000
invasive ductal carcinoma -1.200 0.003
ovarian cancer -2.700 0.000

Synonym

Accession Q8NEB9 Q15134 PI3-kinase type 3
Symbols VPS34
Vps34
hVps34

Gene

PANTHER Protein Class (2)

PDB

3IHY   3LS8   4OYS   4PH4   4UWF   4UWG   4UWH   4UWK   4UWL   5ANL  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (84)

PMID Text
26687681 Study identifies a key role of Cul3-KLHL20 in autophagy termination by controlling autophagy-dependent turnover of ULK1 and VPS34 complex subunits and reveals the pathophysiological functions of this autophagy termination mechanism.
26139536 tubulation requires mTOR activity, and we identified two direct mTOR phosphorylation sites on UVRAG (S550 and S571) that activate VPS34.
25840748 High expression of PI3K core complex genes is associated with poor prognosis in chronic lymphocytic leukemia.
25714112 cis-unsaturated fatty acids require neither BECN1 nor PIK3C3 to stimulate the autophagic flux
25593308 DNA damage regulates Vps34 complexes and its downstream mechanisms, including autophagy and receptor endocytosis, through SCF (Skp1-Cul1-F-box)-mediated ubiquitination and degradation
25402320 Data indicte that Compound 31 constitutes an optimized class III phosphoinositide 3-kinase Vps34 inhibitor that could be used to investigate cancer biology.
25395352 VPS34-IN1 will provide a useful tool to decipher the kinase-dependent functions of Vps34, with acute changes in SGK3 phosphorylation and subcellular localization being new biomarkers of Vps34 activity.
25046113 reveal a novel function of GABP in the regulation of autophagy via transcriptional activation of the BECN1-PIK3C3 complex
24785657 NRBF2 regulates macroautophagy as a component of Vps34 Complex I.
24582588 Insulin can spatially regulate VPS34 activity through Src-mediated tyrosine phosphorylation.
More...

AA Sequence

MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPL      1 - 70
ALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGM     71 - 140
HDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKR    141 - 210
SSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSG    211 - 280
PSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALE    281 - 350
LLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK    351 - 420
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLA    421 - 490
NYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQ    491 - 560
RESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGK    561 - 630
YPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSI    631 - 700
QNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDP    701 - 770
KPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK    771 - 840
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK                           841 - 887
//

Text Mined References (94)

PMID Year Title
26687681 2016 Cul3-KLHL20 Ubiquitin Ligase Governs the Turnover of ULK1 and VPS34 Complexes to Control Autophagy Termination.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26139536 2015 mTOR activates the VPS34-UVRAG complex to regulate autolysosomal tubulation and cell survival.
25840748 2015 High expression of PI3K core complex genes is associated with poor prognosis in chronic lymphocytic leukemia.
25714112 2015 Novel inducers of BECN1-independent autophagy: cis-unsaturated fatty acids.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
25593308 2015 FBXL20-mediated Vps34 ubiquitination as a p53 controlled checkpoint in regulating autophagy and receptor degradation.
25490155 2014 Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex.
25402320 2015 Discovery of (2S)-8-[(3R)-3-methylmorpholin-4-yl]-1-(3-methyl-2-oxobutyl)-2-(trifluoromethyl)-3,4-dihydro-2H-pyrimido[1,2-a]pyrimidin-6-one: a novel potent and selective inhibitor of Vps34 for the treatment of solid tumors.
25395352 2014 Cinderella finds her shoe: the first Vps34 inhibitor uncovers a new PI3K-AGC protein kinase connection.
More...