Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
Funding $456,477.01
PubMed Score 49.31
PubTator Score 19.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.300 0.009
hepatocellular carcinoma 1.400 0.001
pancreatic cancer 2.000 0.001
osteosarcoma -2.226 0.001
group 3 medulloblastoma 1.300 0.004
pancreatic carcinoma 2.000 0.001
spina bifida 1.057 0.029

Synonym

Accession Q8NEB7 Q9BY87
Symbols CT23
SP32
OY-TES-1

Gene

 GO Process (1)

Gene RIF (6)

PMID Text
26189257 OY-TES-1 was expressed in ovarian cancer (OC) tissues with a high proportion, and some of OC tissues presented OY-TES-1 expression in high level vs OC adjacent tissues.
25673160 OY-TES-1 downregulation in liver cancer cells caused 2 opposite effects on cell proliferation: promotion by upregulating CCND2 and CDCA3, and inhibition by CD9 upregulation and NANOG downregulation. OY-TES-1 may play multiple roles in liver cancer.
24294369 OY-TES-1 is frequently expressed in colorectal carcinoma and is able to induce humoral immune response spontaneously in CRC patients.
22651134 The down-regulation of OY-TES-1 expression in bone marrow-derived mesenchymal stem cells caused cell growth inhibition, cell cycle arrest, apoptosis induction and migration ability attenuation.
20876808 High ACRBP expression correlated with reduced survival time and faster relapse among ovarian cancer patients.
16301813 We showed identification of HLA-A24-binding OY-TES-1 peptide, TES(401-409) (KTPFVSPLL) recognized by CD8 T-cells.

AA Sequence

MRKPAAGFLPSLLKVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRN      1 - 70
PTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCSNHVYYAKRVLCSQPVSILSPNTLKEIEA     71 - 140
SAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQE    141 - 210
HKQEEGQKQEEQEEEQEEEGKQEEGQGTKEGREAVSQLQTDSEPKFHSESLSSNPSSFAPRVREVESTPM    211 - 280
IMENIQELIRSAQEIDEMNEIYDENSYWRNQNPGSLLQLPHTEALLVLCYSIVENTCIITPTAKAWKYME    281 - 350
EEILGFGKSVCDSLGRRHMSTCALCDFCSLKLEQCHSEASLQRQQCDTSHKTPFVSPLLASQSLSIGNQV    351 - 420
GSPESGRFYGLDLYGGLHMDFWCARLATKGCEDVRVSGWLQTEFLSFQDGDFPTKICDTDYIQYPNYCSF    421 - 490
KSQQCLMRNRNRKVSRMRCLQNETYSALSPGKSEDVVLRWSQEFSTLTLGQFG                     491 - 543
//

Text Mined References (10)

PMID Year Title
26189257 2015 Cancer testis antigen OY-TES-1: analysis of protein expression in ovarian cancer with tissue microarrays.
25673160 2015 OY-TES-1 may regulate the malignant behavior of liver cancer via NANOG, CD9, CCND2 and CDCA3: a bioinformatic analysis combine with RNAi and oligonucleotide microarray.
24294369 2013 Cancer testis antigen OY-TES-1 expression and serum immunogenicity in colorectal cancer: its relationship to clinicopathological parameters.
22651134 2012 Knockdown of OY-TES-1 by RNAi causes cell cycle arrest and migration decrease in bone marrow-derived mesenchymal stem cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20876808 2010 Tumor antigen acrosin binding protein normalizes mitotic spindle function to promote cancer cell proliferation.
16301813 2005 Identification of an HLA-A24-restricted OY-TES-1 epitope recognized by cytotoxic T-cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11248070 2001 Identification of proacrosin binding protein sp32 precursor as a human cancer/testis antigen.