Property Summary

NCBI Gene PubMed Count 11
PubMed Score 55.06
PubTator Score 19.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count P-value
pancreatic cancer 2398 1.1e-03
pancreatic carcinoma 562 1.1e-03
osteosarcoma 7950 1.2e-03
hepatocellular carcinoma 547 1.6e-03
group 3 medulloblastoma 4104 3.5e-03
gastric cancer 459 1.5e-02
spina bifida 1074 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cowpox 16 3.078 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.200 1.5e-02
group 3 medulloblastoma 1.300 3.5e-03
hepatocellular carcinoma 1.300 1.6e-03
osteosarcoma -2.226 1.2e-03
pancreatic cancer 1.800 1.1e-03
pancreatic carcinoma 1.800 1.1e-03
spina bifida 1.057 2.9e-02

Gene RIF (7)

AA Sequence

MRKPAAGFLPSLLKVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRN      1 - 70
PTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCSNHVYYAKRVLCSQPVSILSPNTLKEIEA     71 - 140
SAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQE    141 - 210
HKQEEGQKQEEQEEEQEEEGKQEEGQGTKEGREAVSQLQTDSEPKFHSESLSSNPSSFAPRVREVESTPM    211 - 280
IMENIQELIRSAQEIDEMNEIYDENSYWRNQNPGSLLQLPHTEALLVLCYSIVENTCIITPTAKAWKYME    281 - 350
EEILGFGKSVCDSLGRRHMSTCALCDFCSLKLEQCHSEASLQRQQCDTSHKTPFVSPLLASQSLSIGNQV    351 - 420
GSPESGRFYGLDLYGGLHMDFWCARLATKGCEDVRVSGWLQTEFLSFQDGDFPTKICDTDYIQYPNYCSF    421 - 490
KSQQCLMRNRNRKVSRMRCLQNETYSALSPGKSEDVVLRWSQEFSTLTLGQFG                     491 - 543
//

Text Mined References (11)

PMID Year Title