Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.18
PubTator Score 9.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (7)

PMID Text
24603412 genetic variants at loci -1053 and +64 of the HTPAP promoter affect the expression of HTPAP, which might be a novel determinant and target for HCC prognosis
24051013 PPAPDC1B and WHSC1L1 played a major role in regulating the survival of breast cancer, pancreatic adenocarcinoma and small-cell lung cancer-derived cell lines.
21531764 Findings identify an HTPAP genotype and associated gene expression pattern that favors metastasis progression and that could be used to predict tumor metastasis and prognosis in HCC patients.
21219541 HTPAP-1 may be the transcript of HTPAP to exhibit a suppressive role on hepatocellular cancer(HCC) metastasis, and can be a prognostic marker for HCC.
18757432 microarray experiments on PPAPDC1B knockdown indicated this gene interfered with cell signaling pathways, including Janus-activated kinase-signal transducer and activator of transcription, mitogen-activated protein kinase, and protein kinase C pathways
17590538 DPPL1 and DPPL2 represent a novel type of mammalian phosphatidate phosphatase.
16261160 HTPAP is a novel metastatic suppressor gene for hepatocellular carcinoma

AA Sequence

MGKAAAAVAFGAEVGVRLALFAAFLVTELLPPFQRLIQPEEMWLYRNPYVEAEYFPTKPMFVIAFLSPLS      1 - 70
LIFLAKFLKKADTRDSRQACLAASLALALNGVFTNTIKLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDV     71 - 140
VNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRFCAFLSPLLFAAVIALSRTCDYKHHW    141 - 210
QDVLVGSMIGMTFAYVCYRQYYPPLTDAECHKPFQDKLVLSTAQKPGDSYCFDI                    211 - 264
//

Text Mined References (11)

PMID Year Title
24603412 2014 Genomic aberrations in the HTPAP promoter affect tumor metastasis and clinical prognosis of hepatocellular carcinoma.
24051013 2013 PPAPDC1B and WHSC1L1 are common drivers of the 8p11-12 amplicon, not only in breast tumors but also in pancreatic adenocarcinomas and lung tumors.
21531764 2011 Association of specific genotypes in metastatic suppressor HTPAP with tumor metastasis and clinical prognosis in hepatocellular carcinoma.
21219541 2011 Downregulation of HTPAP transcript variant 1 correlates with tumor metastasis and poor survival in patients with hepatocellular carcinoma.
18757432 2008 Characterization of the recurrent 8p11-12 amplicon identifies PPAPDC1B, a phosphatase protein, as a new therapeutic target in breast cancer.
17590538 2007 Cloning and characterization of DPPL1 and DPPL2, representatives of a novel type of mammalian phosphatidate phosphatase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16261160 2006 HTPAP gene on chromosome 8p is a candidate metastasis suppressor for human hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...