Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.23
PubTator Score 9.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.100 9.8e-04
atypical teratoid / rhabdoid tumor 1.500 3.7e-05
ductal carcinoma in situ 1.100 2.4e-02
gastric carcinoma -1.400 3.6e-02
glioblastoma 1.300 1.7e-07
group 3 medulloblastoma 2.000 2.1e-04
invasive ductal carcinoma 1.200 4.0e-02
ovarian cancer -1.400 1.4e-05
pancreatic cancer -1.400 1.5e-03
primary pancreatic ductal adenocarcinoma -1.408 1.1e-03
primitive neuroectodermal tumor 1.800 9.3e-05

Gene RIF (7)

AA Sequence

MGKAAAAVAFGAEVGVRLALFAAFLVTELLPPFQRLIQPEEMWLYRNPYVEAEYFPTKPMFVIAFLSPLS      1 - 70
LIFLAKFLKKADTRDSRQACLAASLALALNGVFTNTIKLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDV     71 - 140
VNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRFCAFLSPLLFAAVIALSRTCDYKHHW    141 - 210
QDVLVGSMIGMTFAYVCYRQYYPPLTDAECHKPFQDKLVLSTAQKPGDSYCFDI                    211 - 264
//

Text Mined References (11)

PMID Year Title