Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.51
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Aggressive systemic mastocytosis 6 4.065 2.0

Synonym

Accession Q8NEA9 B2RDW6 Q8TC88 Q8TC89
Symbols GCL
GMCL2
GMCL1L

Gene

Gene RIF (1)

PMID Text
18614560 microsomal epoxide hydrolase and glutamate-cysteine ligase in COPD

AA Sequence

MGSSSSRVLGQPRRALAQQEQGARARGSARRPDTGDDAASYGFCYCPGSHKRKRSSGACRYCDPDSHREE      1 - 70
HEEEGDKQQPLLNTPARKKLRSTSKYIYQTLFLNGENSDIKICALGEEWRLHKIYLCQSGYFSSMFSGSW     71 - 140
KESSMNIIELEIPDQNIDVDALQVAFGSLYRDDVLIKPSRVVAILAAACMLQLDGLIQQCGETMKETINV    141 - 210
KTVCGYYTSVEIYGLDSVKKKCLEWLLNNLMTHQNVKLFKELGINVMKQLIGSSNLFVMQVEMDVYTTLK    211 - 280
KWMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEPGKPFVSVFRHLRLQYIISDLASARIIE    281 - 350
QDGIVPSEWLSSVYKQQWFAMLRAEQDHEVGPQEINKEDLEGSSMRCGRKLAKDGEYYWCWTGFNFGFDL    351 - 420
LVIYTNGYIIFKRNTLNQPCSGSVSLRPRRSIAFRLRLASFDSSGKLVCSRTTGYQILILKKDQEQVVMN    421 - 490
LDSRFLTFPLYICCNFLYISPEKGIENNRHPEDPEN                                      491 - 526
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21156761 2011 A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16201836 2005 Emergence of young human genes after a burst of retroposition in primates.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14528312 2003 Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.