Property Summary

NCBI Gene PubMed Count 35
PubMed Score 28.81
PubTator Score 23.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Congenital hypothyroidism 26 0.0 4.0
Disease Target Count Z-score Confidence
Hypothyroidism 122 4.144 2.1
diabetes mellitus 1728 3.84 1.9
Choanal Atresia 42 3.152 1.6
Disease Target Count
angle-closure glaucoma 7

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.500 5.1e-03
astrocytic glioma 1.800 2.0e-02
Astrocytoma, Pilocytic 1.500 1.6e-04
atypical teratoid / rhabdoid tumor 1.700 1.1e-02
chronic rhinosinusitis -1.340 3.0e-02
cystic fibrosis -1.107 1.5e-04
ependymoma 2.800 3.4e-02
facioscapulohumeral dystrophy -1.500 4.9e-02
glioblastoma 1.100 3.3e-02
group 3 medulloblastoma -2.400 5.9e-04
medulloblastoma, large-cell -3.100 2.8e-07
oligodendroglioma 1.100 8.2e-05
ovarian cancer -1.300 4.9e-02
Pick disease 1.600 1.1e-03
pituitary cancer -3.100 1.3e-09
subependymal giant cell astrocytoma 2.252 1.6e-02
ulcerative colitis 1.100 2.7e-02
urothelial carcinoma -2.000 3.0e-02

Gene RIF (20)

AA Sequence

MMVQRLGLISPPASQVSTACNQISPSLQRAMNAANLNIPPSDTRSLISRESLASTTLSLTESQSASSMKQ      1 - 70
EWSQGYRALPSLSNHGSQNGLDLGDLLSLPPGTSMSSNSVSNSLPSYLFGTESSHSPYPSPRHSSTRSHS     71 - 140
ARSKKRALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGSRASPANLSPQPEVYGHFLGVRGSCIPQPRPV    141 - 210
PGSQKGVLVAPGGLALPAYGEDGALEHERMQQLEHGGLQPGLVNHMVVQHGLPGPDSQSAGLFKTERLEE    211 - 280
FPGSTVDLPPAPPLPPLPPPPGPPPPYHAHAHLHHPELGPHAQQLALPQATLDDDGEMDGIGGKHCCRWI    281 - 350
DCSALYDQQEELVRHIEKVHIDQRKGEDFTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCE    351 - 420
KAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLR    421 - 490
KHVKAHSSKEQQARKKLRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSS    491 - 560
NYSSRSGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAP    561 - 630
SSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVP    631 - 700
SFEDCLVPTSMGQASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSS    701 - 770
VYTEG                                                                     771 - 775
//

Text Mined References (37)

PMID Year Title