Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Substance-Related Disorders 115 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.2e-07
group 4 medulloblastoma 1855 9.4e-03
subependymal giant cell astrocytoma 2287 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.100 9.4e-03
osteosarcoma -2.160 1.2e-07
subependymal giant cell astrocytoma 1.048 4.7e-02

AA Sequence

MDKVQSGFLILFLFLMECQLHLCLPYADGLHPTGNITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGA      1 - 70
ASRSTAASPTNPMKFLRNKAIIRHRPALVKVILISSVAFSIALICGMAISYMIYRLAQAEERQQLESLYK     71 - 140
NLRIPLLGDEEEGSEDEGESTHLLPENENELEKFIHSVIISKRSKNIKKKLKEEQNSVTENKTKNASHNG    141 - 210
KMEDL                                                                     211 - 215
//

Text Mined References (4)

PMID Year Title