Property Summary

NCBI Gene PubMed Count 45
PubMed Score 458.14
PubTator Score 114.57

Knowledge Summary

Patent (7,814)

Expression

Gene RIF (30)

AA Sequence

MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVV      1 - 70
PSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTG     71 - 140
IDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDL    141 - 210
KEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYA    211 - 280
YFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEK    281 - 350
D//

Text Mined References (61)

PMID Year Title