Property Summary

NCBI Gene PubMed Count 34
Grant Count 62
R01 Count 36
Funding $8,142,314.6
PubMed Score 408.94
PubTator Score 114.57

Knowledge Summary

Patent (7,814)

Expression

Synonym

Accession Q8NE86 B2RDF3 B3KXV7 Q96FL3 HsMCU
Symbols HsMCU
C10orf42
CCDC109A

Gene

MCU

PDB

4XSJ   4XTB   5BZ6   5KUE   5KUG   5KUI   5KUJ  

Gene RIF (18)

PMID Text
27001609 Data suggest that MCU regulator (EMRE) might be a structural factor for opening of the mitochondrial calcium uniporter (MCU)-forming pore.
26489515 Our experiments provide novel details about how MCU/EMRE is regulated by MICU1 and an original approach to investigate MCU/EMRE activation in intact cells.
26341627 results suggest that N terminal domain of MCU is essential for the modulation of MCU function, although it does not affect the uniplex formation
25999421 Studies indicate the existence of an inner mitochondrial protein termed the mitochondrial calcium uniporter for calcium transport.
25824785 Loss of heterozygosity of MCU gene on chromosome 10q is associated with pancreatic cancer.
25753332 MCU-VDAC1 complex regulates mitochondrial Ca(2+) uptake and oxidative stress-induced apoptosis
25640838 MCU plays a critical role in breast cancer cell migration by regulating store-operated Ca(2) entry.
24815697 ERp57 can regulate the expression of the mitochondrial calcium uniporter (MCU) and modulate mitochondrial calcium uptake
24430870 SLC25A23 augments mitochondrial Ca(2) uptake, interacts with MCU, and induces oxidative stress-mediated cell death.
24366263 We review not only the biochemical identities and structures of the proteins required for mitochondrial Ca2+ uptake but also their implications in different physiopathological contexts. [review]
More...

AA Sequence

MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVV      1 - 70
PSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTG     71 - 140
IDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDL    141 - 210
KEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYA    211 - 280
YFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEK    281 - 350
D//

Text Mined References (50)

PMID Year Title
27184846 2016 MCUR1 Is a Scaffold Factor for the MCU Complex Function and Promotes Mitochondrial Bioenergetics.
27135929 2016 Architecture of the mitochondrial calcium uniporter.
27099988 2016 Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex.
27001609 2016 Analysis of the structure and function of EMRE in a yeast expression system.
26976564 2016 Mitochondrial calcium uniporter regulator 1 (MCUR1) regulates the calcium threshold for the mitochondrial permeability transition.
26903221 2016 Functional roles of MICU1 and MICU2 in mitochondrial Ca(2+) uptake.
26489515 2015 Rearrangement of MICU1 multimers for activation of MCU is solely controlled by cytosolic Ca(2.).
26387864 2015 The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake.
26341627 2015 Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter.
25999421 2015 The ins and outs of mitochondrial calcium.
More...