Property Summary

NCBI Gene PubMed Count 21
PubMed Score 36.99
PubTator Score 18.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.300 2.4e-04
Astrocytoma, Pilocytic 1.900 3.1e-06
ependymoma 1.100 6.3e-05
glioblastoma 1.200 1.3e-03
lung adenocarcinoma -1.100 4.9e-11
medulloblastoma, large-cell 1.200 3.1e-04
non-small cell lung carcinoma -1.200 2.2e-23
osteosarcoma 2.173 4.9e-04
pituitary cancer -1.300 6.6e-04

 CSPA Cell Line (1)

Pathway (1)

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPTTLHLHMIFLR      1 - 70
GMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKIEKELSGMYRRLFEPLRVPPD     71 - 140
LFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMH    141 - 210
KGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQ    211 - 280
LSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPAS    281 - 350
PNTLKVHQLP                                                                351 - 360
//

Text Mined References (23)

PMID Year Title