Property Summary

NCBI Gene PubMed Count 19
Grant Count 21
R01 Count 10
Funding $2,571,661
PubMed Score 36.08
PubTator Score 18.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.173 0.000
posterior fossa group A ependymoma 1.800 0.000
glioblastoma 1.600 0.000
medulloblastoma, large-cell 1.200 0.000
lung adenocarcinoma -1.100 0.000
adult high grade glioma 1.600 0.006
pilocytic astrocytoma 1.900 0.000
non-small cell lung carcinoma -1.200 0.000
pituitary cancer -1.300 0.001

Gene RIF (11)

PMID Text
26642364 Forced expression of POPDC1(S201F) in a murine cardiac muscle cell line (HL-1) increased hyperpolarization and upstroke velocity of the action potential
24442236 These results suggest that down-regulation of BVES in hepatocellular carcinoma induces epithelial-mesenchymal transition, thus promoting invasion and metastasis in HCC cells.
23403794 Coding sequence and splice junctions of BVES were sequenced in 114 unrelated patients with Tetralogy of Fallot and 400 unrelated healthy individuals.Four novel BVES mutations were identified in patients with TOF but not in the 400 controls.
22354168 Popdc1 (Bves) modulates cardiac pacemaker activity in response to stress and displays high expression levels in the sinus node. The Popeye domain acts as a high-affinity cAMP binding domain and Popdc proteins interact with the ion channel TREK-1.
22109561 Low Bves expression is associated with gastric cancer progression.
21911938 BVES was found to be underexpressed in all stages of colorectal carcinoma and in adenomatous polyps, indicating its suppression occurs early in transformation.
21283798 Bves expression and localization can regulate RhoA and ZONAB/DbpA activity.
21069264 Data suggest that POPDC gene expression is modified in end-stage heart failure in humans in a manner suggesting regulatory and/or functional differences between the three family members and that POPDC1 is particularly susceptible to this condition.
20627872 Frequent silencing of BVES is associated with promoter hypermethylation in gastric cancer.
20546612 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPTTLHLHMIFLR      1 - 70
GMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKIEKELSGMYRRLFEPLRVPPD     71 - 140
LFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMH    141 - 210
KGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQ    211 - 280
LSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPAS    281 - 350
PNTLKVHQLP                                                                351 - 360
//

Text Mined References (21)

PMID Year Title
26642364 2016 POPDC1(S201F) causes muscular dystrophy and arrhythmia by affecting protein trafficking.
24442236 2014 BVES inhibition triggers epithelial-mesenchymal transition in human hepatocellular carcinoma.
23403794 2013 Mutational and functional analysis of the BVES gene coding region in Chinese patients with non-syndromic tetralogy of Fallot.
22354168 2012 Popeye domain containing proteins are essential for stress-mediated modulation of cardiac pacemaking in mice.
22109561 2012 Abnormal expression of adhesion protein Bves is associated with gastric cancer progression and poor survival.
21911938 2011 BVES regulates EMT in human corneal and colon cancer cells and is silenced via promoter methylation in human colorectal carcinoma.
21283798 2011 Bves modulates tight junction associated signaling.
21069264 2011 Popeye domain-containing 1 is down-regulated in failing human hearts.
20627872 2010 Frequent silencing of popeye domain-containing genes, BVES and POPDC3, is associated with promoter hypermethylation in gastric cancer.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
More...