Property Summary

NCBI Gene PubMed Count 30
PubMed Score 15.68
PubTator Score 18.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Hypersensitivity 63 0.0 0.0
Pneumonia 174 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 3.100 4.7e-02
astrocytoma 1.200 4.3e-02
diabetes mellitus 1.700 3.4e-03
mucosa-associated lymphoid tissue lympho... -1.057 2.3e-02
ovarian cancer 1.800 7.0e-06
psoriasis 1.300 1.3e-04

Gene RIF (15)

AA Sequence

MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDKKIKKTFFEELAVEDKQAGEEEKVLKEKEQQQQQQQ      1 - 70
QQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQS     71 - 140
EEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAALDNEEEDKEEEIIKE    141 - 210
KEPPKQGKEKAKKAEQGSEEEGEGEEEEEEGGESKADDPYAHLSKKEKKKLKKQMEYERQVASLKAANAA    211 - 280
ENDFSVSQAEMSSRQAMLENASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIA    281 - 350
NRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELR    351 - 420
ATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWL    421 - 490
NNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKE    491 - 560
LKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEESQEAPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGV    561 - 630
TFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQ    631 - 700
LRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPT    701 - 770
NNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMV    771 - 840
SRPRE                                                                     841 - 845
//

Text Mined References (42)

PMID Year Title