Property Summary

NCBI Gene PubMed Count 30
Grant Count 1
R01 Count 1
Funding $93,534.6
PubMed Score 13.68
PubTator Score 18.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.300 0.000
astrocytoma 1.200 0.043
diabetes mellitus 2.600 0.002
mucosa-associated lymphoid tissue lympho... -1.057 0.023
acute myeloid leukemia 3.100 0.047
ovarian cancer 1.800 0.000

Gene RIF (15)

PMID Text
25929864 Elevated microRNA-23a Expression Enhances the Chemoresistance of Colorectal Cancer Cells with Microsatellite Instability to 5-Fluorouracil by Directly Targeting ABCF1
25904329 ABCF1 extrinsically regulates retinal pigment epithelial cell phagocytosis of shed photoreceptor outer segments.
25597744 expression of ABC50 mutants, which cannot hydrolyse ATP, decreases general translation and relaxes the discrimination against the use of non-AUG codons at translation start sites.
24908204 The results suggested that SNPs at PRR3 and ABCF1 genes and the haplotype composed by SNPs at GNL1 and PRR3 between the HLA-A and HLA-C genes tended to predict Graves ophthalmology in a gender-dependent manner in patients with Graves disease in Taiwan.
24634119 A rare copy number variation of the ABCF1 gene was detected among dengue patients from Malaysia.
23719290 ABCF1 showed a significant increase in expression after escitalopram treatment.
23263557 ABCF1 is a critical protein that associates with viral double-stranded DNA.
22174317 HIV-1 Rev interacting protein, ATP-binding cassette, sub-family F (ABCF1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with ABCF1 is increased by RRE
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19912639 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDKKIKKTFFEELAVEDKQAGEEEKVLKEKEQQQQQQQ      1 - 70
QQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQS     71 - 140
EEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAALDNEEEDKEEEIIKE    141 - 210
KEPPKQGKEKAKKAEQGSEEEGEGEEEEEEGGESKADDPYAHLSKKEKKKLKKQMEYERQVASLKAANAA    211 - 280
ENDFSVSQAEMSSRQAMLENASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIA    281 - 350
NRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELR    351 - 420
ATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWL    421 - 490
NNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKE    491 - 560
LKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEESQEAPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGV    561 - 630
TFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQ    631 - 700
LRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPT    701 - 770
NNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMV    771 - 840
SRPRE                                                                     841 - 845
//

Text Mined References (42)

PMID Year Title
25929864 2015 Elevated microRNA-23a Expression Enhances the Chemoresistance of Colorectal Cancer Cells with Microsatellite Instability to 5-Fluorouracil by Directly Targeting ABCF1.
25904329 2015 ABCF1 extrinsically regulates retinal pigment epithelial cell phagocytosis.
25597744 2015 ABC50 mutants modify translation start codon selection.
24908204 2014 Single nucleotide polymorphisms at the PRR3, ABCF1, and GNL1 genes in the HLA class I region are associated with Graves' ophthalmopathy in a gender-dependent manner.
24634119 2014 A novel rare copy number variant of the ABCF1 gene identified among dengue fever patients from Peninsular Malaysia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23719290 2013 ATP-binding cassette sub-family F member 1 (ABCF1) is identified as a putative therapeutic target of escitalopram in the inflammatory cytokine pathway.
23263557 2013 Identification of regulators of the innate immune response to cytosolic DNA and retroviral infection by an integrative approach.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...