Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $62,533.29
PubMed Score 2.17
PubTator Score 1.08

Knowledge Summary

Patent (1,509)

TINX Plot

Expression

Gene RIF (2)

PMID Text
25630557 Analysis of these mutants revealed that HIPK1, HIPK2 and HIPK3 but not HIPK4 are capable of autophosphorylating on other tyrosines
18022393 homeodomain interacting protein kinase 4 could phosphorylate human p53 protein at serine 9, both in vitro and in vivo

AA Sequence

MSTIQSETDCYDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRNRIIKNELKLLHCMRGLDPEEA      1 - 70
HVIRFLEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQVLTALARLKELAIIHADLKPE     71 - 140
NIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRFYRAPEILLGLPFCEKVDVWSLGCVMAELHL    141 - 210
GWPLYPGNNEYDQVRYICETQGLPKPHLLHAACKAHHFFKRNPHPDAANPWQLKSSADYLAETKVRPLER    211 - 280
RKYMLKSLDQIETVNGGSVASRLTFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQ    281 - 350
QLRSAHETTHYYQLSLRSYRLSLQVEGKPPTPVVAAEDGTPYYCLAEEKEAAGMGSVAGSSPFFREEKAP    351 - 420
GMQRAIDQLDDLSLQEAGHGLWGETCTNAVSDMMVPLKAAITGHHVPDSGPEPILAFYSSRLAGRHKARK    421 - 490
PPAGSKSDSNFSNLIRLSQVSPEDDRPCRGSSWEEGEHLGASAEPLAILQRDEDGPNIDNMTMEAERPDP    491 - 560
ELFDPSSCPGEWLSEPDCTLESVRGPRAQGLPPRRSHQHGPPRGATSFLQHVTGHH                  561 - 616
//

Text Mined References (9)

PMID Year Title
25630557 2015 Effect of tyrosine autophosphorylation on catalytic activity and subcellular localisation of homeodomain-interacting protein kinases (HIPK).
25416956 2014 A proteome-scale map of the human interactome network.
24225127 2014 Integration of stress signals by homeodomain interacting protein kinases.
20508833 2010 Characterization of Human Homeodomain-interacting Protein Kinase 4 (HIPK4) as a Unique Member of the HIPK Family.
18022393 2007 Novel homeodomain-interacting protein kinase family member, HIPK4, phosphorylates human p53 at serine 9.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.