Property Summary

NCBI Gene PubMed Count 19
PubMed Score 24.81
PubTator Score 136.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 4.73099317936194E-48
lung carcinoma 2844 1.23291464387456E-35
pituitary cancer 1972 4.6230615962553E-15
ovarian cancer 8492 3.80495655965255E-6
atypical teratoid / rhabdoid tumor 4369 2.5860159814754E-5
osteosarcoma 7933 2.09166224034306E-4
group 3 medulloblastoma 2254 3.31673824724996E-4
medulloblastoma, large-cell 6234 5.91607607624101E-4
pilocytic astrocytoma 3086 0.003745315394014
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00433160481312666
inflammatory breast cancer 404 0.00482144175052806
fibroadenoma 557 0.0296675447975803

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.162 0.000
group 3 medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.200 0.001
intraductal papillary-mucinous carcinoma... 1.200 0.004
fibroadenoma 1.800 0.030
pilocytic astrocytoma 1.500 0.004
inflammatory breast cancer -1.500 0.005
lung carcinoma 2.600 0.000
ovarian cancer -1.200 0.000
pituitary cancer -2.600 0.000
psoriasis -1.200 0.000

Synonym

Accession Q8NE62 Q9NY17 CDH
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (14)

PMID Text
25483962 CHDH is not a substrate of PARK2 but interacts with SQSTM1 independently of PARK2 to recruit SQSTM1 into depolarized mitochondria
22558321 The rs12676 single nucleotide polymorphism is associated with altered sperm motility patterns and dysmorphic mitochondrial structure in sperm.
22387881 the PEMT -774G>C and CHDH +432G>T polymorphisms were associated with sperm concentration. This finding suggests a possible influence of these genes on sperm quality
21308979 CHDH and PLD2 as novel candidate genes, the nucleotide variants of which could be associated with the risk of tooth agenesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20662904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20175737 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20031640 CHDH A119C and MTHFR C677T play an important role in modulating the homocysteine levels in Indian population.
19737740 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MWCLLRGLGRPGALARGALGQQQSLGARALASAGSESRDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLL      1 - 70
EAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGRVWGGSSSLNAMVYV     71 - 140
RGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASRYRGADGPLRVSRGKTNHPLHCAFLEATQQAG    141 - 210
YPLTEDMNGFQQEGFGWMDMTIHEGKRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKN    211 - 280
GQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPI    281 - 350
TLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY    351 - 420
QVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGS    421 - 490
HIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPT    491 - 560
IMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR                                        561 - 594
//

Text Mined References (21)

PMID Year Title
25483962 2014 Choline dehydrogenase interacts with SQSTM1/p62 to recruit LC3 and stimulate mitophagy.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
22558321 2012 Choline dehydrogenase polymorphism rs12676 is a functional variation and is associated with changes in human sperm cell function.
22387881 2012 Phosphatidylethanolamine N-methyltransferase and choline dehydrogenase gene polymorphisms are associated with human sperm concentration.
21308979 2011 Polymorphisms in CHDH gene and the risk of tooth agenesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20662904 2010 Polymorphisms located in the region containing BHMT and BHMT2 genes as maternal protective factors for orofacial clefts.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...