Property Summary

NCBI Gene PubMed Count 19
Grant Count 3
R01 Count 2
Funding $476,539.33
PubMed Score 20.39
PubTator Score 18.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (9)

PMID Text
26497556 Data show that EGF receptor (EGFR) is involved in the microRNA miR-107 pathogenesis of hepatocellular carcinoma (HCC) through cytoplasmic polyadenylation element binding protein 3 (CPEB3).
25066254 Data suggest that the RNA recognition motif (RRM) domain of CPEB3 (as a soluble peptide fragment) exhibits protein conformation distinct from those of the canonical RRM domain.
22711986 cleavage of CPEB3 by NMDA-activated calpain 2 accounts for the activity-related translation of CPEB3-targeted RNAs
21336257 Together, these results indicate that Tob mediates the recruitment of Caf1 to the target of CPEB3 and elicits deadenylation and decay of the mRNA.
20524672 Secondary structure determination and native gel analyses reveal that the cleaved population of the CPEB3 ribozyme has a single, secondary structure that closely resembles the HDV ribozyme
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19503753 Observational study of gene-disease association. (HuGE Navigator)
16990549 isolation of a ribozyme conserved mammalian sequence that resides in an intron of the CPEB3 gene
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQDDLLMDKSKTQPQPQQQQRQQQQPQPESSVSEAPSTPLSSETPKPEENSAVPALSPAAAPPAPNGPDK      1 - 70
MQMESPLLPGLSFHQPPQQPPPPQEPAAPGASLSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFP     71 - 140
HHVNPVFGGTFSPQIGLAQTQHHQQPPPPAPAPQPAQPAQPPQAQPPQQRRSPASPSQAPYAQRSAAAAY    141 - 210
GHQPIMTSKPSSSSAVAAAAAAAAASSASSSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGV    211 - 280
GVPSPLNPISPLKKPFSSNVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLE    281 - 350
NSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNNAFLDDSHGDQAL    351 - 420
SSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLL    421 - 490
FQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPL    491 - 560
RAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYV    561 - 630
LDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS      631 - 698
//

Text Mined References (24)

PMID Year Title
26497556 2016 MicroRNA-107: a novel promoter of tumor progression that targets the CPEB3/EGFR axis in human hepatocellular carcinoma.
26398195 2015 Global Analysis of CPEBs Reveals Sequential and Non-Redundant Functions in Mitotic Cell Cycle.
25066254 2014 Novel RNA recognition motif domain in the cytoplasmic polyadenylation element binding protein 3.
24343026 2014 Identifying RNA-binding residues based on evolutionary conserved structural and energetic features.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22730302 2012 NMDAR signaling facilitates the IPO5-mediated nuclear import of CPEB3.
22711986 2012 Calpain 2 activated through N-methyl-D-aspartic acid receptor signaling cleaves CPEB3 and abrogates CPEB3-repressed translation in neurons.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...