Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.14
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 9.36027392824498E-23
breast carcinoma 1614 7.77444624660389E-22
lung adenocarcinoma 2714 2.65948837392231E-14
ovarian cancer 8492 1.59585276091441E-11
group 4 medulloblastoma 1875 1.94919266129589E-7
medulloblastoma, large-cell 6234 2.89610107069546E-5
atypical teratoid / rhabdoid tumor 4369 3.81996486802418E-5
invasive ductal carcinoma 2950 4.2730052434794E-5
adult high grade glioma 2148 7.54257531435826E-5
lung cancer 4473 9.08610684109726E-5
glioblastoma 5572 1.28842612596748E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.73628305064215E-4
pituitary cancer 1972 3.31617925083427E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.21113814672151E-4
cystic fibrosis 1670 0.00120027914473346
head and neck cancer 270 0.00304774967761077
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00379721088447383
ductal carcinoma in situ 1745 0.00986056204630043
Endometriosis 535 0.0228311513728398

Expression

Gene RIF (2)

PMID Text
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFSCFCFSLQDNSFSSTTVTECDEDPVSLHEDQTDCSSLRDENNKENYPDAGALVEEHAPPSWEPQQQNV      1 - 70
EATVLVDSVLRPSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHESPQNNAFKCQ     71 - 140
ETVRLQPRIDQRTAISPKDAFETRQDLNEEEAAQVHGVKDPAPASTQSVLADGTDSADPSPVHKDGQNEA    141 - 210
DSAPEDLHSVGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSTQQFMMPRSSSRCSCGDG    211 - 280
KEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKELKLKLSEE    281 - 350
QGSAPKGPPRNLLCEQPTVPRENGKPEAAGPEPSSSGEETPDAALTCLKERREQLPPQEDSKVTKQDKNL    351 - 420
IKPLYDRYRIIKQILSTPSLIPTIQEEEDSDEDRPQGSQQPSLADPASHLPVGDHLTYSNETEPVRALLP    421 - 490
DEKKEVKPPALSMSNLHEATMPVLLDHLRETRADKKRLRKALREFEEQFFKQTGRSPQKEDRIPMADEYY    491 - 560
EYKHIKAKLRLLEVLISKQDVAKTI                                                 561 - 585
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...