Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.89
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.600 7.5e-05
atypical teratoid / rhabdoid tumor -2.300 3.8e-05
breast carcinoma -1.400 7.8e-22
cystic fibrosis 1.379 1.2e-03
ductal carcinoma in situ -1.200 9.9e-03
Endometriosis -1.121 2.3e-02
glioblastoma -1.100 2.3e-03
group 4 medulloblastoma -2.400 1.9e-07
head and neck cancer -1.500 3.0e-03
intraductal papillary-mucinous adenoma (... -2.900 2.7e-04
intraductal papillary-mucinous carcinoma... -2.900 6.2e-04
intraductal papillary-mucinous neoplasm ... -3.200 3.8e-03
invasive ductal carcinoma -2.700 4.3e-05
lung adenocarcinoma -1.300 2.7e-14
lung cancer 2.000 9.1e-05
medulloblastoma, large-cell -2.400 2.9e-05
non-small cell lung cancer -2.176 9.4e-23
ovarian cancer -4.000 1.6e-11
pituitary cancer 1.600 3.3e-04

Gene RIF (2)

AA Sequence

MFSCFCFSLQDNSFSSTTVTECDEDPVSLHEDQTDCSSLRDENNKENYPDAGALVEEHAPPSWEPQQQNV      1 - 70
EATVLVDSVLRPSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHESPQNNAFKCQ     71 - 140
ETVRLQPRIDQRTAISPKDAFETRQDLNEEEAAQVHGVKDPAPASTQSVLADGTDSADPSPVHKDGQNEA    141 - 210
DSAPEDLHSVGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSTQQFMMPRSSSRCSCGDG    211 - 280
KEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKELKLKLSEE    281 - 350
QGSAPKGPPRNLLCEQPTVPRENGKPEAAGPEPSSSGEETPDAALTCLKERREQLPPQEDSKVTKQDKNL    351 - 420
IKPLYDRYRIIKQILSTPSLIPTIQEEEDSDEDRPQGSQQPSLADPASHLPVGDHLTYSNETEPVRALLP    421 - 490
DEKKEVKPPALSMSNLHEATMPVLLDHLRETRADKKRLRKALREFEEQFFKQTGRSPQKEDRIPMADEYY    491 - 560
EYKHIKAKLRLLEVLISKQDVAKTI                                                 561 - 585
//

Text Mined References (13)

PMID Year Title