Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q8NE22 F5H713
Symbols C5orf35

Gene

AA Sequence

MPGRLLRGLWQRWRRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLGTLLKVFQALFLNDFNK      1 - 70
QSEILSMLPESVKSKYQDLLAVEHQGVKLLENRHQQQSTFKPEEILYKTLGFSVAQATSSLISAGKGVFV     71 - 140
TKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLDGVLIDGNDKGISKVVYRSCNGRDRLGPLKM    141 - 210
SDSTWLTSEIHNPLAVGQYVNNCSNDRAANVCYQEFDVPAVFPIELKQYLPNIAYSYDKQSPLRCVVLVA    211 - 280
LRDINQGEELFSNYYTIVS                                                       281 - 299
//

Text Mined References (4)

PMID Year Title
20930037 2011 Uncovering the human methyltransferasome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.