Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.54
PubTator Score 4.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.500 1.5e-04
Astrocytoma, Pilocytic 1.100 1.2e-05
Atopic dermatitis -1.500 4.1e-07
atypical teratoid/rhabdoid tumor 1.100 2.4e-04
Breast cancer 1.100 6.8e-03
chronic rhinosinusitis -1.349 4.5e-02
ductal carcinoma in situ -1.300 2.9e-03
ependymoma 2.700 5.0e-14
glioblastoma 1.100 4.3e-05
lung adenocarcinoma -1.500 4.0e-10
lung carcinoma -1.400 3.0e-05
nasopharyngeal carcinoma -1.100 2.6e-07
non-small cell lung carcinoma -1.100 7.0e-11
pituitary cancer 1.100 4.2e-04

Gene RIF (6)

AA Sequence

MPEKRLTAEPPTITEEEFEDSLATDDFLVDYFNEFLSLPTFSEAIRFNADYGVFEVANDAPQFLEKQLKK      1 - 70
ILQNQQPRNPIYDVVRKGKNEVKPVQMNAPDEDETINVNYNIMCLSREEGIKWIKKERLPAFLESDCYFE     71 - 140
YRLAKLVSQVRWSKSGMNFTVGSNFSPWIVKKPPSLPPPATEEDNLVIMKKFYVSLGEASYTQTKDWFAL    141 - 210
AKQSQQTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLISEFEEEEGEEEEVSV    211 - 280
SLQDTPSQALLRVYLEKKQDVDESLTMHFSTCEEFLSSYIYFILRGAIQQIVGKPVGETPDYINFNNITK    281 - 350
VSFDDCFESIHGKNFLSELVQTTKERSEEIEQTSLSSKNESAGPESRADWCISHRTYDIGNRKEFERFKK    351 - 420
FIKGTLGERYWWLWMDIERLKVLKDPGRHQRHLEKMKKCYLVSNGDYYLSAEILSKFKLLDGSQWNEEHL    421 - 490
RNIQSEVLKPLLLYWAPRFCVTHSASTKYASAELKFWHLRQAKPRKDIDPFPQMATLLPLRPKSCIPQIP    491 - 560
EIQKEEFSLSQPPKSPNKSPEVKTATQKPWKRELLYPGSSKDDVIEKGSKYMSESSKVIHLTSFTDISEC    561 - 630
LKPQLDRRYAYTEEPRVKTVSDVGALGGSDMENLLQSLYVENRAGFFFTKFCEHSGNKLWKNSVYFWFDL    631 - 700
QAYHQLFYQETLQPFKVCKQAQYLFATYVAPSATLDIGLQQEKKKEIYMKIQPPFEDLFDTAEEYILLLL    701 - 770
LEPWTKMVKSDQIAYKKVELVEETRQLDSTYFRKLQALHKETFSKKAEDTTCEIGTGILSLSNVSKRTEY    771 - 840
WDNVPAEYKHFKFSDLLNNKLEFEHFRQFLETHSSSMDLMCWTDIEQFRRITYRDRNQRKAKSIYIKNKY    841 - 910
LNKKYFFGPNSPASLYQQNQVMHLSGGWGKILHEQLDAPVLVEIQKHVQNRLENVWLPLFLASEQFAARQ    911 - 980
KIKVQMKDIAEELLLQKAEKKIGVWKPVESKWISSSCKIIAFRKALLNPVTSRQFQRFVALKGDLLENGL    981 - 1050
LFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSSIPPALQIDIPVEQAQKIIEHRKELGPYVFREAQ   1051 - 1120
MTIFGVLFKFWPQFCEFRKNLTDENIMSVLERRQEYNKQKKKLAVLEDEKSGKDGIKQYANTSVPAIKTA   1121 - 1190
LLSDSFLGLQPYGRQPTWCYSKYIEALEQERILLKIQEELEKKLFAGLQPLTNFKASSSTMSLKKNMSAH   1191 - 1260
SSQK                                                                     1261 - 1264
//

Text Mined References (12)

PMID Year Title