Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.73
PubTator Score 4.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Basal cell carcinoma 31
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.45442746203888E-16
non-small cell lung carcinoma 413 7.01513853976907E-11
lung adenocarcinoma 2714 4.01383863819876E-10
nasopharyngeal carcinoma 1056 2.60608445377649E-7
Atopic dermatitis 944 4.08408520590017E-7
pilocytic astrocytoma 3086 1.9873230434122E-5
lung carcinoma 2844 2.99087564484836E-5
adult high grade glioma 2148 1.47069528104976E-4
atypical teratoid/rhabdoid tumor 1095 2.3795141426808E-4
pituitary cancer 1972 4.15115730337328E-4
glioblastoma 5572 8.37539840455993E-4
ductal carcinoma in situ 1745 0.00292558405788089
Breast cancer 3099 0.00676182171973109
chronic rhinosinusitis 512 0.0454851041398126
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Hypertrophy of breast 20 4.143 2.1

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma 3.700 0.000
glioblastoma 1.200 0.001
Atopic dermatitis -1.500 0.000
lung adenocarcinoma -1.500 0.000
adult high grade glioma 1.500 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
pilocytic astrocytoma 1.100 0.000
nasopharyngeal carcinoma -1.100 0.000
lung carcinoma -1.400 0.000
non-small cell lung carcinoma -1.100 0.000
Breast cancer 1.100 0.007
ductal carcinoma in situ -1.300 0.003
pituitary cancer 1.100 0.000
chronic rhinosinusitis -1.349 0.045

Synonym

Accession Q8NE09 A8K944 Q569L2 Q86Y71 Q9BYZ4 Q9UFN6 RGS22
Symbols CT145
PRTD-NY2

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (6)

PMID Text
26323264 RGS22 acts as a tumor suppressor, repressing human pancreatic adenocarcinoma cell migration by coupling to GNA12/13.
24403052 New basal cell carcinoma susceptibility loci were identified at TGM3 (rs214782) and RGS22(rs7006527).
21533872 Over-expression of RGS22 in a highly metastatic esophageal cancer cell line causes decrease in cell migration and reduction in the invasive potential of the cells.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18703424 RGS22 may also play a role in GNA13 translocation from the cytoplasm to the nucleus during spermiogenesis

AA Sequence

MPEKRLTAEPPTITEEEFEDSLATDDFLVDYFNEFLSLPTFSEAIRFNADYGVFEVANDAPQFLEKQLKK      1 - 70
ILQNQQPRNPIYDVVRKGKNEVKPVQMNAPDEDETINVNYNIMCLSREEGIKWIKKERLPAFLESDCYFE     71 - 140
YRLAKLVSQVRWSKSGMNFTVGSNFSPWIVKKPPSLPPPATEEDNLVIMKKFYVSLGEASYTQTKDWFAL    141 - 210
AKQSQQTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLISEFEEEEGEEEEVSV    211 - 280
SLQDTPSQALLRVYLEKKQDVDESLTMHFSTCEEFLSSYIYFILRGAIQQIVGKPVGETPDYINFNNITK    281 - 350
VSFDDCFESIHGKNFLSELVQTTKERSEEIEQTSLSSKNESAGPESRADWCISHRTYDIGNRKEFERFKK    351 - 420
FIKGTLGERYWWLWMDIERLKVLKDPGRHQRHLEKMKKCYLVSNGDYYLSAEILSKFKLLDGSQWNEEHL    421 - 490
RNIQSEVLKPLLLYWAPRFCVTHSASTKYASAELKFWHLRQAKPRKDIDPFPQMATLLPLRPKSCIPQIP    491 - 560
EIQKEEFSLSQPPKSPNKSPEVKTATQKPWKRELLYPGSSKDDVIEKGSKYMSESSKVIHLTSFTDISEC    561 - 630
LKPQLDRRYAYTEEPRVKTVSDVGALGGSDMENLLQSLYVENRAGFFFTKFCEHSGNKLWKNSVYFWFDL    631 - 700
QAYHQLFYQETLQPFKVCKQAQYLFATYVAPSATLDIGLQQEKKKEIYMKIQPPFEDLFDTAEEYILLLL    701 - 770
LEPWTKMVKSDQIAYKKVELVEETRQLDSTYFRKLQALHKETFSKKAEDTTCEIGTGILSLSNVSKRTEY    771 - 840
WDNVPAEYKHFKFSDLLNNKLEFEHFRQFLETHSSSMDLMCWTDIEQFRRITYRDRNQRKAKSIYIKNKY    841 - 910
LNKKYFFGPNSPASLYQQNQVMHLSGGWGKILHEQLDAPVLVEIQKHVQNRLENVWLPLFLASEQFAARQ    911 - 980
KIKVQMKDIAEELLLQKAEKKIGVWKPVESKWISSSCKIIAFRKALLNPVTSRQFQRFVALKGDLLENGL    981 - 1050
LFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSSIPPALQIDIPVEQAQKIIEHRKELGPYVFREAQ   1051 - 1120
MTIFGVLFKFWPQFCEFRKNLTDENIMSVLERRQEYNKQKKKLAVLEDEKSGKDGIKQYANTSVPAIKTA   1121 - 1190
LLSDSFLGLQPYGRQPTWCYSKYIEALEQERILLKIQEELEKKLFAGLQPLTNFKASSSTMSLKKNMSAH   1191 - 1260
SSQK                                                                     1261 - 1264
//

Text Mined References (12)

PMID Year Title
26323264 2015 RGS22 inhibits pancreatic adenocarcinoma cell migration through the G12/13 ? subunit/F-actin pathway.
24403052 2014 Germline sequence variants in TGM3 and RGS22 confer risk of basal cell carcinoma.
21533872 2011 RGS22, a novel cancer/testis antigen, inhibits epithelial cell invasion and metastasis.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18703424 2008 RGS22, a novel testis-specific regulator of G-protein signaling involved in human and mouse spermiogenesis along with GNA12/13 subunits.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...