Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.73
PubTator Score 4.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma 3.700 0.000
glioblastoma 1.200 0.001
Atopic dermatitis -1.500 0.000
lung adenocarcinoma -1.500 0.000
adult high grade glioma 1.500 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
pilocytic astrocytoma 1.100 0.000
nasopharyngeal carcinoma -1.100 0.000
lung carcinoma -1.400 0.000
non-small cell lung carcinoma -1.100 0.000
Breast cancer 1.100 0.007
ductal carcinoma in situ -1.300 0.003
pituitary cancer 1.100 0.000
chronic rhinosinusitis -1.349 0.045

Gene RIF (6)

PMID Text
26323264 RGS22 acts as a tumor suppressor, repressing human pancreatic adenocarcinoma cell migration by coupling to GNA12/13.
24403052 New basal cell carcinoma susceptibility loci were identified at TGM3 (rs214782) and RGS22(rs7006527).
21533872 Over-expression of RGS22 in a highly metastatic esophageal cancer cell line causes decrease in cell migration and reduction in the invasive potential of the cells.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18703424 RGS22 may also play a role in GNA13 translocation from the cytoplasm to the nucleus during spermiogenesis

AA Sequence

MPEKRLTAEPPTITEEEFEDSLATDDFLVDYFNEFLSLPTFSEAIRFNADYGVFEVANDAPQFLEKQLKK      1 - 70
ILQNQQPRNPIYDVVRKGKNEVKPVQMNAPDEDETINVNYNIMCLSREEGIKWIKKERLPAFLESDCYFE     71 - 140
YRLAKLVSQVRWSKSGMNFTVGSNFSPWIVKKPPSLPPPATEEDNLVIMKKFYVSLGEASYTQTKDWFAL    141 - 210
AKQSQQTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLISEFEEEEGEEEEVSV    211 - 280
SLQDTPSQALLRVYLEKKQDVDESLTMHFSTCEEFLSSYIYFILRGAIQQIVGKPVGETPDYINFNNITK    281 - 350
VSFDDCFESIHGKNFLSELVQTTKERSEEIEQTSLSSKNESAGPESRADWCISHRTYDIGNRKEFERFKK    351 - 420
FIKGTLGERYWWLWMDIERLKVLKDPGRHQRHLEKMKKCYLVSNGDYYLSAEILSKFKLLDGSQWNEEHL    421 - 490
RNIQSEVLKPLLLYWAPRFCVTHSASTKYASAELKFWHLRQAKPRKDIDPFPQMATLLPLRPKSCIPQIP    491 - 560
EIQKEEFSLSQPPKSPNKSPEVKTATQKPWKRELLYPGSSKDDVIEKGSKYMSESSKVIHLTSFTDISEC    561 - 630
LKPQLDRRYAYTEEPRVKTVSDVGALGGSDMENLLQSLYVENRAGFFFTKFCEHSGNKLWKNSVYFWFDL    631 - 700
QAYHQLFYQETLQPFKVCKQAQYLFATYVAPSATLDIGLQQEKKKEIYMKIQPPFEDLFDTAEEYILLLL    701 - 770
LEPWTKMVKSDQIAYKKVELVEETRQLDSTYFRKLQALHKETFSKKAEDTTCEIGTGILSLSNVSKRTEY    771 - 840
WDNVPAEYKHFKFSDLLNNKLEFEHFRQFLETHSSSMDLMCWTDIEQFRRITYRDRNQRKAKSIYIKNKY    841 - 910
LNKKYFFGPNSPASLYQQNQVMHLSGGWGKILHEQLDAPVLVEIQKHVQNRLENVWLPLFLASEQFAARQ    911 - 980
KIKVQMKDIAEELLLQKAEKKIGVWKPVESKWISSSCKIIAFRKALLNPVTSRQFQRFVALKGDLLENGL    981 - 1050
LFWQEVQKYKDLCHSHCDESVIQKKITTIINCFINSSIPPALQIDIPVEQAQKIIEHRKELGPYVFREAQ   1051 - 1120
MTIFGVLFKFWPQFCEFRKNLTDENIMSVLERRQEYNKQKKKLAVLEDEKSGKDGIKQYANTSVPAIKTA   1121 - 1190
LLSDSFLGLQPYGRQPTWCYSKYIEALEQERILLKIQEELEKKLFAGLQPLTNFKASSSTMSLKKNMSAH   1191 - 1260
SSQK                                                                     1261 - 1264
//

Text Mined References (12)

PMID Year Title
26323264 2015 RGS22 inhibits pancreatic adenocarcinoma cell migration through the G12/13 ? subunit/F-actin pathway.
24403052 2014 Germline sequence variants in TGM3 and RGS22 confer risk of basal cell carcinoma.
21533872 2011 RGS22, a novel cancer/testis antigen, inhibits epithelial cell invasion and metastasis.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18703424 2008 RGS22, a novel testis-specific regulator of G-protein signaling involved in human and mouse spermiogenesis along with GNA12/13 subunits.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...