Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8NDZ9
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAASGSPGPTPSPGPGRTPAEPAAAGPSRRELRNGSYLSTVPTARLWAADRAGGPGRPSRSGAARRGGGG      1 - 70
GYRSALRPIVSLPRGSRRSRAREPGSSPARHLLPPLWKRPPPPRAARPGPRLRASGPARLTGRRQPSPQR     71 - 140
PQPPPYWRGPFPAARALRSRTPAVRAPARLGDARPGLQVPGAPRREAGAGSPGPKAGLRGTQTSDIGVSS    141 - 210
RQVRG                                                                     211 - 215
//

Text Mined References (1)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).