Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.49
PubTator Score 7.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.144 0.004
juvenile dermatomyositis 1.084 0.000
primary pancreatic ductal adenocarcinoma 1.574 0.001
adult high grade glioma -1.100 0.006
Breast cancer -1.300 0.000
ovarian cancer -1.400 0.002

Synonym

Accession Q8NDZ4 B2RCF2 B7Z1W3
Symbols DIA1
HASF
GoPro49

Gene

Gene RIF (1)

PMID Text
21264219 results support a model where the DIA1 and DIA1R regulate molecular traffic through the cellular secretory pathway or affect the function of secreted factors, and functional deficits cause disorders with ASD-like symptoms and/or mental retardation

AA Sequence

MWRLVPPKLGRLSRSLKLAALGSLLVLMVLHSPSLLASWQRNELTDRRFLQLNKCPACFGTSWCRRFLNG      1 - 70
QVVFEAWGRLRLLDFLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPRCDLLQA     71 - 140
MPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLVRRYAETKDSGSFLLRNLKDSERMQLLLTLA    141 - 210
FNPEPLVLQSFPSDEGWPFAKYLGACGRMVAVNYVGEELWSYFNAPWEKRVDLAWQLMEIAEQLTNNDFE    211 - 280
FALYLLDVSFDNFAVGPRDGKVIIVDAENVLVADKRLIRQNKPENWDVWYESKFDDCDKEACLSFSKEIL    281 - 350
CARATVDHNYYAVCQNLLSRHATWRGTSGGLLHDPPSEIAKDGRLEALLDECANPKKRYGRFQAAKELRE    351 - 420
YLAQLSNNVR                                                                421 - 430
//

Text Mined References (13)

PMID Year Title
24269490 2014 HASF is a stem cell paracrine factor that activates PKC epsilon mediated cytoprotection.
23784961 2013 C3orf58, a novel paracrine protein, stimulates cardiomyocyte cell-cycle progression through the PI3K-AKT-CDK7 pathway.
21283809 2011 Characterization of the deleted in autism 1 protein family: implications for studying cognitive disorders.
21264219 2011 DIA1R is an X-linked gene related to Deleted In Autism-1.
18651652 2008 Expression of the novel Golgi protein GoPro49 is developmentally regulated during mesenchymal differentiation.
18621663 2008 Identifying autism loci and genes by tracing recent shared ancestry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...