Property Summary

NCBI Gene PubMed Count 7
PubMed Score 14.47
PubTator Score 0.98

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
pituitary cancer 1972 3.53399917285225E-8
tuberculosis 1563 1.54032263491907E-6
ovarian cancer 8492 1.57690167585966E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00441279351214425
osteosarcoma 7933 0.00882473097514026
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0139912066041523
subependymal giant cell astrocytoma 2287 0.0184749803028569
oligodendroglioma 2849 0.036563213617295


  Differential Expression (8)


Accession Q8NDZ2 J3KQQ8 Q6NXN8 Q6ZTU4 Q8IZ15
Symbols OOMA1


  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG

Gene RIF (1)

23707407 Authors found that PLEIAD also interacts with CTBP1 (C-terminal binding protein 1), a transcriptional co-regulator, and CTBP1 is proteolyzed in COS7 cells expressing CAPN3.

AA Sequence

LQDKVHLLKLLLFYAADLNPDAEPFQKGWSGS                                          841 - 872

Text Mined References (9)

PMID Year Title
23707407 2013 PLEIAD/SIMC1/C5orf25, a novel autolysis regulator for a skeletal-muscle-specific calpain, CAPN3, scaffolds a CAPN3 substrate, CTBP1.
23086935 2012 Poly-small ubiquitin-like modifier (PolySUMO)-binding proteins identified through a string search.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.