Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $48,120
PubMed Score 7.52
PubTator Score 4.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Multiple Sclerosis 498

Gene RIF (2)

PMID Text
15363390 Knockout mouse retinal dysfunction resembles human congenital stationary night blindness.
11863370 Mouse Bhlhe23 can function as a transcriptional repressor.

AA Sequence

MAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPAQAAESSGEQSG      1 - 70
DEDDAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSK     71 - 140
IATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAF    141 - 210
SGTPSALCKHCHEKP                                                           211 - 225
//

Text Mined References (10)

PMID Year Title
23756994 2013 Classification and evolutionary analysis of the basic helix-loop-helix gene family in the green anole lizard, Anolis carolinensis.
18557763 2008 Phylogenetic and expression analysis of the basic helix-loop-helix transcription factor gene family: genomic approach to cellular differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363390 2004 The transcription factor Bhlhb4 is required for rod bipolar cell maturation.
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12617822 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
11863370 2002 BHLHB4 is a bHLH transcriptional regulator in pancreas and brain that marks the dimesencephalic boundary.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.