Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.69
PubTator Score 4.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Multiple Sclerosis 540 5.8e-04

Gene RIF (3)

AA Sequence

MAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPAQAAESSGEQSG      1 - 70
DEDDAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSK     71 - 140
IATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAF    141 - 210
SGTPSALCKHCHEKP                                                           211 - 225
//

Text Mined References (11)

PMID Year Title