Property Summary

NCBI Gene PubMed Count 4
Grant Count 3
Funding $743,441
PubMed Score 45.71
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.090 0.000
medulloblastoma, large-cell 1.200 0.000
tuberculosis and treatment for 3 months 1.200 0.000

Gene RIF (2)

PMID Text
20700443 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
12203785 The product of the ETV6-MDS2 fusion transcript in a patient with myelodysplastic syndrome predicts a short ETV6 protein containing the first 54 amino acids of ETV6 plus four novel amino acids, lacking both the PTN and the DNA-binding domains.

AA Sequence

MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMRGGARGRPQLT      1 - 70
LERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPCEDPARGWLSANPGREPSPGICWHLNLGLPSLHNCEE     71 - 140
//

Text Mined References (4)

PMID Year Title
20700443 2010 Genome-wide association studies of serum magnesium, potassium, and sodium concentrations identify six Loci influencing serum magnesium levels.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12203785 2002 A novel gene, MDS2, is fused to ETV6/TEL in a t(1;12)(p36.1;p13) in a patient with myelodysplastic syndrome.