Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.03
PubTator Score 10.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 4.4e-05
osteosarcoma 7950 1.1e-03
Disease Target Count Z-score Confidence
Uveal melanoma 20 3.049 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 4.4e-05
osteosarcoma 1.180 1.1e-03

Gene RIF (1)

AA Sequence

MEKFKAAMLLGSVGDALGYRNVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALT      1 - 70
TDYWCLDDLYREMVRCYVEIVEKLPERRPDPATIEGCAQLKPNNYLLAWHTPFNEKGSGFGAATKAMCIG     71 - 140
LRYWKPERLETLIEVSVECGRMTHNHPTGFLGSLCTALFVSFAAQGKPLVQWGRDMLRAVPLAEEYCRKT    141 - 210
IRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYRKWSSEGRGGRRGHDAPMIA    211 - 280
YDALLAAGNSWTELCHRAMFHGGESAATGTIAGCLFGLLYGLDLVPKGLYQDLEDKEKLEDLGAALYRLS    281 - 350
TEEK                                                                      351 - 354
//

Text Mined References (6)

PMID Year Title