Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.45
PubTator Score 3.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (6)

AA Sequence

MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIV      1 - 70
RGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQAL     71 - 140
NLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS             141 - 201
//

Text Mined References (13)

PMID Year Title