Property Summary

NCBI Gene PubMed Count 16
PubMed Score 110.26
PubTator Score 33.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Deafness, autosomal dominant 25 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 7.8e-08
pituitary cancer 1972 6.1e-03
posterior fossa group B ependymoma 416 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.8
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 3.478 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
pituitary cancer 1.200 6.1e-03
posterior fossa group B ependymoma 1.100 1.4e-02
psoriasis -1.700 7.8e-08

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (9)

AA Sequence

MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRPSPPLCDCHCC      1 - 70
GLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTAQFNWDPETVGLIHGSFFWGY     71 - 140
IMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKW    141 - 210
APPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTIS    211 - 280
NEEKTYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAIS    281 - 350
KVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL    351 - 420
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALV    421 - 490
HYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEEIELNHESFASPKKKMSYGATSQNCEVQKK    491 - 560
EWKGQRGATLDEEELTSYQNEERNFSTIS                                             561 - 589
//

Text Mined References (17)

PMID Year Title