Property Summary

NCBI Gene PubMed Count 14
Grant Count 44
R01 Count 27
Funding $5,734,134.25
PubMed Score 103.11
PubTator Score 33.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 0.014
pituitary cancer 1.200 0.006
psoriasis -1.700 0.000

Gene RIF (7)

PMID Text
26797701 The results from our study suggest that the p.M206Nfs*4 mutation in the SLC17A8 gene is likely a pathogenic mutation that causes autosomal dominant non-syndromic hearing loss.
26558771 The absence of VGLUT3 in transgenic mice leads to an up-regulation of the midbrain dopamine system and ameliorates motor dysfunction in a model of Parkinson's disease.
26239290 The results of this study identify VGLUT3 as an unexpected regulator of drug abuse.
18674745 SLC17A8 encodes vesicular glutamate transporter-3, VGLUT3 and its impairment has a role in nonsyndromic deafness DFNA25 and inner hair cell dysfunction
18498073 VGLUT3 immunoreactivity covered only a limited portion of the possible Glu-ergic pathways in the human fetal small intestine.
17660252 Docking and homology modeling explain the inhibition of VGLUT3.
12151341 human vesicular glutamate transporter 3 was cloned, shows 72% identity to both hVGLUT1 and hVGLUT2, and its expression in brain overlaps with hVGLUT1 and hVGLUT2

AA Sequence

MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRPSPPLCDCHCC      1 - 70
GLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTAQFNWDPETVGLIHGSFFWGY     71 - 140
IMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKW    141 - 210
APPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTIS    211 - 280
NEEKTYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAIS    281 - 350
KVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL    351 - 420
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALV    421 - 490
HYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEEIELNHESFASPKKKMSYGATSQNCEVQKK    491 - 560
EWKGQRGATLDEEELTSYQNEERNFSTIS                                             561 - 589
//

Text Mined References (15)

PMID Year Title
26797701 2016 Screening of the SLC17A8 gene as a causative factor for autosomal dominant non-syndromic hearing loss in Koreans.
26558771 2015 Loss of VGLUT3 Produces Circadian-Dependent Hyperdopaminergia and Ameliorates Motor Dysfunction and l-Dopa-Mediated Dyskinesias in a Model of Parkinson's Disease.
26239290 2015 The absence of VGLUT3 predisposes to cocaine abuse by increasing dopamine and glutamate signaling in the nucleus accumbens.
23341777 2013 Genome-wide association study identifies a novel susceptibility locus at 12q23.1 for lung squamous cell carcinoma in han chinese.
18674745 2008 Impairment of SLC17A8 encoding vesicular glutamate transporter-3, VGLUT3, underlies nonsyndromic deafness DFNA25 and inner hair cell dysfunction in null mice.
18498073 2008 Developmental pattern of three vesicular glutamate transporters in the myenteric plexus of the human fetal small intestine.
17660252 2007 Docking and homology modeling explain inhibition of the human vesicular glutamate transporters.
16722234 2006 The diverse roles of vesicular glutamate transporter 3.
16516863 2006 Distribution of vesicular glutamate transporters in rat and human retina.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...