Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.09
PubTator Score 2.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -2.400 0.000
osteosarcoma -2.266 0.000
posterior fossa group A ependymoma -1.300 0.000
glioblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.400 0.002
medulloblastoma, large-cell -1.100 0.002
lung cancer 1.200 0.003
adult high grade glioma -1.900 0.000
lung carcinoma 1.300 0.000
ovarian cancer -1.300 0.002

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNKSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSNLVSVGYCITKPEVIFKIEQGEEPWILE      1 - 70
KGFPSQCHPERKWKVDDVLESSQENEDDHFWELLFHNNKTVSVENGDRGSKTFNLGTDPVSLRNYPYKIC     71 - 140
DSCEMNLKNISGLIISKKNCSRKKPDEFNVCEKLLLDIRHEKIPIGEKSYKYDQKRNAINYHQDLSQPSF    141 - 210
GQSFEYSKNGQGFHDEAAFFTNKRSQIGETVCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFC    211 - 280
MNLRFGHQRALTKDNPYEYNEYGEIFCDNSAFIIHQGAYTRKILREYKVSDKTWEKSALLKHQIVHMGGK    281 - 350
SYDYNENGSNFSKKSHLTQLRRAHTGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKAFCQK    351 - 420
PHLTNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACGKSFCHRSALTVHQRTHTGEK    421 - 490
PFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRTHTGEKPYECNACGKTFSQR    491 - 560
SVLTKHQRIHTRVKALSTS                                                       561 - 579
//

Text Mined References (7)

PMID Year Title
19553259 2009 Common body mass index-associated variants confer risk of extreme obesity.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12566394 2003 Genomic sequence and transcriptional profile of the boundary between pericentromeric satellites and genes on human chromosome arm 10p.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.