Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.09
PubTator Score 2.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Obesity 678 0.0 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.900 6.5e-05
atypical teratoid / rhabdoid tumor -1.400 1.9e-03
ependymoma -1.200 2.8e-07
glioblastoma -1.400 1.7e-06
lung cancer 1.200 2.6e-03
lung carcinoma 1.300 2.3e-14
medulloblastoma, large-cell -1.100 2.1e-03
osteosarcoma 1.296 1.1e-05
ovarian cancer -1.300 1.5e-03
psoriasis -2.400 5.2e-05

Gene RIF (2)

AA Sequence

MNKSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSNLVSVGYCITKPEVIFKIEQGEEPWILE      1 - 70
KGFPSQCHPERKWKVDDVLESSQENEDDHFWELLFHNNKTVSVENGDRGSKTFNLGTDPVSLRNYPYKIC     71 - 140
DSCEMNLKNISGLIISKKNCSRKKPDEFNVCEKLLLDIRHEKIPIGEKSYKYDQKRNAINYHQDLSQPSF    141 - 210
GQSFEYSKNGQGFHDEAAFFTNKRSQIGETVCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFC    211 - 280
MNLRFGHQRALTKDNPYEYNEYGEIFCDNSAFIIHQGAYTRKILREYKVSDKTWEKSALLKHQIVHMGGK    281 - 350
SYDYNENGSNFSKKSHLTQLRRAHTGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKAFCQK    351 - 420
PHLTNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACGKSFCHRSALTVHQRTHTGEK    421 - 490
PFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRTHTGEKPYECNACGKTFSQR    491 - 560
SVLTKHQRIHTRVKALSTS                                                       561 - 579
//

Text Mined References (9)

PMID Year Title