Property Summary

NCBI Gene PubMed Count 54
Grant Count 30
R01 Count 21
Funding $3,686,744.66
PubMed Score 112.28
PubTator Score 88.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 0.019
ependymoma 1.300 0.008
oligodendroglioma 1.200 0.012
osteosarcoma 1.943 0.000
medulloblastoma 1.200 0.008
medulloblastoma, large-cell 1.100 0.000
fascioscapulohumeral muscular dystrophy 1.176 0.000
juvenile dermatomyositis 1.122 0.000
Pick disease -1.100 0.000
progressive supranuclear palsy -1.100 0.011
ovarian cancer -2.400 0.000

Gene RIF (26)

PMID Text
26446993 The results indicate that TNRC6A subcellular localization is substantially controlled by the interaction with Argonaute proteins.
24778252 TRIM65 relieves miRNA-driven suppression of mRNA expression through ubiquitination and subsequent degradation of TNRC6.
24023945 HIV-1 Nef inhibits the sorting of GW182 into exosomes, leading to affect assembly and turnover of the miRNA-induced silencing complex (miRISC)
23224975 Sinse Argonaute and GW182 are the core proteins of the RNA-silencing complex (RISC), it seems appropriate to suggest that the RISC is the main target of human autoantibodies. (Review)
23224974 28.6% of patients containing autoantibodies to the trinucleotide repeat region of the TNRC6A were shown to have a single nucleotide polymorphism at c.344C>A in the CAG/CCA/G-rich region of TNRC6A.
23224969 GW182 proteins function as scaffold proteins for the assembly of the multiprotein complex that silences miRNA targets. (Review)
23224966 GW182 plays a critical role in miRNA-mediated gene silencing. (Review)
23150874 Analysis of the results suggested that TNRC6A plays an important role in navigating Argonaute protein into the nucleus to lead miRNA-mediated gene silencing.
23090477 we have identified a new function of GW182 in protecting mature miRNA from being degraded by interacting with Argonaute (AGO) proteins
22898980 HSP90 and GW182 are important factors in the pathomechanism of alcohol-induced augmentation of HCV replication.
More...

AA Sequence

MRELEAKATKDVERNLSRDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQKIKVPEQIKPSVSQPQPAN      1 - 70
SNNGTSTATSTNNNAKRATANNQQPQQQQQQQQPQQQQPQQQPQPQPQQQQPQQQPQALPRYPREVPPRF     71 - 140
RHQEHKQLLKRGQHFPVIAANLGSAVKVLNSQSESSALTNQQPQNNGEVQNSKNQSDINHSTSGSHYENS    141 - 210
QRGPVSSTSDSSTNCKNAVVSDLSEKEAWPSAPGSDPELASECMDADSASSSESERNITIMASGNTGGEK    211 - 280
DGLRNSTGLGSQNKFVVGSSSNNVGHGSSTGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSS    281 - 350
SSNGGLNPSTLNSASNHGAWPVLENNGLALKGPVGSGSSGINIQCSTIGQMPNNQSINSKVSGGSTHGTW    351 - 420
GSLQETCESEVSGTQKVSFSGQPQNITTEMTGPNNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMNH    421 - 490
PQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNATLMQPGVNGPMG    491 - 560
TNFQVNTNKGGGVWESGAANSQSTSWGSGNGANSGGSRRGWGTPAQNTGTNLPSVEWNKLPSNQHSNDSA    561 - 630
NGNGKTFTNGWKSTEEEDQGSATSQTNEQSSVWAKTGGTVESDGSTESTGRLEEKGTGESQSRDRRKIDQ    631 - 700
HTLLQSIVNRTDLDPRVLSNSGWGQTPIKQNTAWDTETSPRGERKTDNGTEAWGSSATQTFNSGACIDKT    701 - 770
SPNGNDTSSVSGWGDPKPALRWGDSKGSNCQGGWEDDSAATGMVKSNQWGNCKEEKAAWNDSQKNKQGWG    771 - 840
DGQKSSQGWSVSASDNWGETSRNNHWGEANKKSSSGGSDSDRSVSGWNELGKTSSFTWGNNINPNNSSGW    841 - 910
DESSKPTPSQGWGDPPKSNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPPATGKPPGTGWLGGPIPAPAK    911 - 980
EEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS    981 - 1050
NKEASSGSGWGEPWGEPSTPATTVDNGTSAWGKPIDSGPSWGEPIAAASSTSTWGSSSVGPQALSKSGPK   1051 - 1120
SMQDGWCGDDMPLPGNRPTGWEEEEDVEIGMWNSNSSQELNSSLNWPPYTKKMSSKGLSGKKRRRERGMM   1121 - 1190
KGGNKQEEAWINPFVKQFSNISFSRDSPEENVQSNKMDLSGGMLQDKRMEIDKHSLNIGDYNRTVGKGPG   1191 - 1260
SRPQISKESSMERNPYFDKDGIVADESQNMQFMSSQSMKLPPSNSALPNQALGSIAGLGMQNLNSVRQNG   1261 - 1330
NPSMFGVGNTAAQPRGMQQPPAQPLSSSQPNLRAQVPPPLLSPQVPVSLLKYAPNNGGLNPLFGPQQVAM   1331 - 1400
LNQLSQLNQLSQISQLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSVQQQMMQQSRQLDPNLLVKQQT   1401 - 1470
PPSQQQPLHQPAMKSFLDNVMPHTTPELQKGPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWTT   1471 - 1540
VDSISVNTSLDQNSSKHGAISSGFRLEESPFVPYDFMNSSTSPASPPGSIGDGWPRAKSPNGSSSVNWPP   1541 - 1610
EFRPGEPWKGYPNIDPETDPYVTPGSVINNLSINTVREVDHLRDRNSGSSSSLNTTLPSTSAWSSIRASN   1611 - 1680
YNVPLSSTAQSTSARNSDSKLTWSPGSVTNTSLAHELWKVPLPPKNITAPSRPPPGLTGQKPPLSTWDNS   1681 - 1750
PLRIGGGWGNSDARYTPGSSWGESSSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNAL   1751 - 1820
VRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEEEISRFFAQSQSLTPSPGWQSLGSSQSRLGSLDCSHS   1821 - 1890
FSSRTDLNHWNGAGLSGTNCGDLHGTSLWGTPHYSTSLWGPPSSSDPRGISSPSPINAFLSVDHLGGGGE   1891 - 1960
SM                                                                       1961 - 1962
//

Text Mined References (63)

PMID Year Title
26446993 2015 Control of the localization and function of a miRNA silencing component TNRC6A by Argonaute protein.
26134560 2015 Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.
25416956 2014 A proteome-scale map of the human interactome network.
24778252 2014 TRIM65 regulates microRNA activity by ubiquitination of TNRC6.
24768540 2014 A DDX6-CNOT1 complex and W-binding pockets in CNOT9 reveal direct links between miRNA target recognition and silencing.
23386860 2013 Exploring genome-wide - dietary heme iron intake interactions and the risk of type 2 diabetes.
23224975 2013 Reflections on ten years of history of, and future prospects for, GW182 and GW/P body research.
23224974 2013 An SNP in the trinucleotide repeat region of the TNRC6A gene maps to a major TNGW1 autoepitope in patients with autoantibodies to GW182.
23224969 2013 The role of GW182 proteins in miRNA-mediated gene silencing.
23224966 2013 Function of GW182 and GW bodies in siRNA and miRNA pathways.
More...