Property Summary

NCBI Gene PubMed Count 54
PubMed Score 112.28
PubTator Score 88.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 3.34142894568978E-11
juvenile dermatomyositis 1189 4.47174192539911E-9
osteosarcoma 7933 2.4491757635933E-6
medulloblastoma, large-cell 6234 1.24649453330984E-4
fascioscapulohumeral muscular dystrophy 100 1.82990306431523E-4
Pick disease 1893 3.61288462460734E-4
ependymoma 2514 0.00785325076589614
medulloblastoma 1524 0.0081887162901876
progressive supranuclear palsy 674 0.0110828382337679
oligodendroglioma 2849 0.0124049648390267
astrocytic glioma 2241 0.0187670322642058
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Sensory peripheral neuropathy 5 3.794 1.9
Primary biliary cirrhosis 45 3.522 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 0.019
ependymoma 1.300 0.008
oligodendroglioma 1.200 0.012
osteosarcoma 1.943 0.000
medulloblastoma 1.200 0.008
medulloblastoma, large-cell 1.100 0.000
fascioscapulohumeral muscular dystrophy 1.176 0.000
juvenile dermatomyositis 1.122 0.000
Pick disease -1.100 0.000
progressive supranuclear palsy -1.100 0.011
ovarian cancer -2.400 0.000

Synonym

Accession Q8NDV7 C9JAR8 O15408 Q658L5 Q6NVB5 Q8NEZ0 Q8TBT8 Q8TCR0 Q9NV59 Q9P268
Symbols GW1
GW182
TNRC6
CAGH26

Gene

  Ortholog (11)

Gene RIF (26)

PMID Text
26446993 The results indicate that TNRC6A subcellular localization is substantially controlled by the interaction with Argonaute proteins.
24778252 TRIM65 relieves miRNA-driven suppression of mRNA expression through ubiquitination and subsequent degradation of TNRC6.
24023945 HIV-1 Nef inhibits the sorting of GW182 into exosomes, leading to affect assembly and turnover of the miRNA-induced silencing complex (miRISC)
23224975 Sinse Argonaute and GW182 are the core proteins of the RNA-silencing complex (RISC), it seems appropriate to suggest that the RISC is the main target of human autoantibodies. (Review)
23224974 28.6% of patients containing autoantibodies to the trinucleotide repeat region of the TNRC6A were shown to have a single nucleotide polymorphism at c.344C>A in the CAG/CCA/G-rich region of TNRC6A.
23224969 GW182 proteins function as scaffold proteins for the assembly of the multiprotein complex that silences miRNA targets. (Review)
23224966 GW182 plays a critical role in miRNA-mediated gene silencing. (Review)
23150874 Analysis of the results suggested that TNRC6A plays an important role in navigating Argonaute protein into the nucleus to lead miRNA-mediated gene silencing.
23090477 we have identified a new function of GW182 in protecting mature miRNA from being degraded by interacting with Argonaute (AGO) proteins
22898980 HSP90 and GW182 are important factors in the pathomechanism of alcohol-induced augmentation of HCV replication.
More...

AA Sequence

MRELEAKATKDVERNLSRDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQKIKVPEQIKPSVSQPQPAN      1 - 70
SNNGTSTATSTNNNAKRATANNQQPQQQQQQQQPQQQQPQQQPQPQPQQQQPQQQPQALPRYPREVPPRF     71 - 140
RHQEHKQLLKRGQHFPVIAANLGSAVKVLNSQSESSALTNQQPQNNGEVQNSKNQSDINHSTSGSHYENS    141 - 210
QRGPVSSTSDSSTNCKNAVVSDLSEKEAWPSAPGSDPELASECMDADSASSSESERNITIMASGNTGGEK    211 - 280
DGLRNSTGLGSQNKFVVGSSSNNVGHGSSTGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSS    281 - 350
SSNGGLNPSTLNSASNHGAWPVLENNGLALKGPVGSGSSGINIQCSTIGQMPNNQSINSKVSGGSTHGTW    351 - 420
GSLQETCESEVSGTQKVSFSGQPQNITTEMTGPNNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMNH    421 - 490
PQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNATLMQPGVNGPMG    491 - 560
TNFQVNTNKGGGVWESGAANSQSTSWGSGNGANSGGSRRGWGTPAQNTGTNLPSVEWNKLPSNQHSNDSA    561 - 630
NGNGKTFTNGWKSTEEEDQGSATSQTNEQSSVWAKTGGTVESDGSTESTGRLEEKGTGESQSRDRRKIDQ    631 - 700
HTLLQSIVNRTDLDPRVLSNSGWGQTPIKQNTAWDTETSPRGERKTDNGTEAWGSSATQTFNSGACIDKT    701 - 770
SPNGNDTSSVSGWGDPKPALRWGDSKGSNCQGGWEDDSAATGMVKSNQWGNCKEEKAAWNDSQKNKQGWG    771 - 840
DGQKSSQGWSVSASDNWGETSRNNHWGEANKKSSSGGSDSDRSVSGWNELGKTSSFTWGNNINPNNSSGW    841 - 910
DESSKPTPSQGWGDPPKSNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPPATGKPPGTGWLGGPIPAPAK    911 - 980
EEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS    981 - 1050
NKEASSGSGWGEPWGEPSTPATTVDNGTSAWGKPIDSGPSWGEPIAAASSTSTWGSSSVGPQALSKSGPK   1051 - 1120
SMQDGWCGDDMPLPGNRPTGWEEEEDVEIGMWNSNSSQELNSSLNWPPYTKKMSSKGLSGKKRRRERGMM   1121 - 1190
KGGNKQEEAWINPFVKQFSNISFSRDSPEENVQSNKMDLSGGMLQDKRMEIDKHSLNIGDYNRTVGKGPG   1191 - 1260
SRPQISKESSMERNPYFDKDGIVADESQNMQFMSSQSMKLPPSNSALPNQALGSIAGLGMQNLNSVRQNG   1261 - 1330
NPSMFGVGNTAAQPRGMQQPPAQPLSSSQPNLRAQVPPPLLSPQVPVSLLKYAPNNGGLNPLFGPQQVAM   1331 - 1400
LNQLSQLNQLSQISQLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSVQQQMMQQSRQLDPNLLVKQQT   1401 - 1470
PPSQQQPLHQPAMKSFLDNVMPHTTPELQKGPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWTT   1471 - 1540
VDSISVNTSLDQNSSKHGAISSGFRLEESPFVPYDFMNSSTSPASPPGSIGDGWPRAKSPNGSSSVNWPP   1541 - 1610
EFRPGEPWKGYPNIDPETDPYVTPGSVINNLSINTVREVDHLRDRNSGSSSSLNTTLPSTSAWSSIRASN   1611 - 1680
YNVPLSSTAQSTSARNSDSKLTWSPGSVTNTSLAHELWKVPLPPKNITAPSRPPPGLTGQKPPLSTWDNS   1681 - 1750
PLRIGGGWGNSDARYTPGSSWGESSSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNAL   1751 - 1820
VRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEEEISRFFAQSQSLTPSPGWQSLGSSQSRLGSLDCSHS   1821 - 1890
FSSRTDLNHWNGAGLSGTNCGDLHGTSLWGTPHYSTSLWGPPSSSDPRGISSPSPINAFLSVDHLGGGGE   1891 - 1960
SM                                                                       1961 - 1962
//

Text Mined References (63)

PMID Year Title
26446993 2015 Control of the localization and function of a miRNA silencing component TNRC6A by Argonaute protein.
26134560 2015 Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.
25416956 2014 A proteome-scale map of the human interactome network.
24778252 2014 TRIM65 regulates microRNA activity by ubiquitination of TNRC6.
24768540 2014 A DDX6-CNOT1 complex and W-binding pockets in CNOT9 reveal direct links between miRNA target recognition and silencing.
23386860 2013 Exploring genome-wide - dietary heme iron intake interactions and the risk of type 2 diabetes.
23224975 2013 Reflections on ten years of history of, and future prospects for, GW182 and GW/P body research.
23224974 2013 An SNP in the trinucleotide repeat region of the TNRC6A gene maps to a major TNGW1 autoepitope in patients with autoantibodies to GW182.
23224969 2013 The role of GW182 proteins in miRNA-mediated gene silencing.
23224966 2013 Function of GW182 and GW bodies in siRNA and miRNA pathways.
More...