Property Summary

NCBI Gene PubMed Count 9
PubMed Score 19.58
PubTator Score 7.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count Z-score Confidence
Infertility 163 3.256 1.6

Expression

Synonym

Accession Q8NDV3 A0AV46 B0QY23 B0QY24 Q5TIC3 Q6ZUF9 Q9Y3G5 SMC protein 1B
Symbols SMC1L2
SMC1BETA

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25216700 High SMC1B expression is associated with pancreatic cancer.
21875947 HIV-1 Vpr decreases the amount of Smc1 and Smc3 proteins in the chromatin
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MAHLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIHGAHI      1 - 70
GKPISSSASVKIIYVEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNCLVFQGTV     71 - 140
ESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQ    141 - 210
SLLEELKMNKIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQT    211 - 280
EKELKSVETLLNQKRPQYIKAKENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSF    281 - 350
EKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGN    351 - 420
LKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFNEELNLIRSELQNAGID    421 - 490
THEGKRQQKRAEVLEHLKRLYPDSVFGRLFDLCHPIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFL    491 - 560
KEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIAL    561 - 630
SGPERQKTVALDGTLFLKSGVISGGSSDLKYKARCWDEKELKNLRDRRSQKIQELKGLMKTLRKETDLKQ    631 - 700
IQTLIQGTQTRLKYSQNELEMIKKKHLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKID    701 - 770
KVEDDIFQHFCEEIGVENIREFENKHVKRQQEIDQKRYFYKKMLTRLNVQLEYSRSHLKKKLNKINTLKE    771 - 840
TIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLAVDREVGKLQK    841 - 910
EVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSLDDIIEVEMGTEAESTQATIDIYEKEEAFEIDYS    911 - 980
SLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPNLRALENLKTVRDKFQESTDAFEASRKEARL    981 - 1050
CRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQAFLSPENPEEPYLEGISYNCVAPGKRFMP   1051 - 1120
MDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISLKEEFY   1121 - 1190
SRADALIGIYPEYDDCMFSRVLTLDLSQYPDTEGQESSKRHGESR                            1191 - 1235
//

Text Mined References (11)

PMID Year Title
25216700 2015 Protein deep sequencing applied to biobank samples from patients with pancreatic cancer.
21242291 2011 RAD21L, a novel cohesin subunit implicated in linking homologous chromosomes in mammalian meiosis.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660695 2004 The evolution of SMC proteins: phylogenetic analysis and structural implications.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11564881 2001 Novel meiosis-specific isoform of mammalian SMC1.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
More...