Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.49
PubTator Score 6.61

Knowledge Summary

Patent (2,717)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -4.500 8.4e-05
astrocytic glioma -2.000 2.1e-03
Astrocytoma, Pilocytic -4.600 2.2e-08
atypical teratoid / rhabdoid tumor -4.900 5.1e-10
diabetes mellitus 1.100 1.1e-03
ependymoma -2.300 6.5e-04
glioblastoma -4.200 9.6e-11
group 3 medulloblastoma -3.900 4.7e-03
lung carcinoma 1.600 3.8e-12
medulloblastoma, large-cell -3.900 8.0e-03
oligodendroglioma -1.700 1.6e-02
ovarian cancer -1.100 4.7e-06
primitive neuroectodermal tumor -4.700 7.7e-05

Gene RIF (4)

AA Sequence

MNSWDAGLAGLLVGTMGVSLLSNALVLLCLLHSADIRRQAPALFTLNLTCGNLLCTVVNMPLTLAGVVAQ      1 - 70
RQPAGDRLCRLAAFLDTFLAANSMLSMAALSIDRWVAVVFPLSYRAKMRLRDAALMVAYTWLHALTFPAA     71 - 140
ALALSWLGFHQLYASCTLCSRRPDERLRFAVFTGAFHALSFLLSFVVLCCTYLKVLKVARFHCKRIDVIT    141 - 210
MQTLVLLVDLHPSVRERCLEEQKRRRQRATKKISTFIGTFLVCFAPYVITRLVELFSTVPIGSHWGVLSK    211 - 280
CLAYSKAASDPFVYSLLRHQYRKSCKEILNRLLHRRSIHSSGLTGDSHSQNILPVSE                 281 - 337
//

Text Mined References (13)

PMID Year Title