Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.04
PubTator Score 6.61

Knowledge Summary

Patent (2,717)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.000 0.002
ependymoma -4.500 0.000
oligodendroglioma -1.700 0.016
glioblastoma -4.800 0.000
medulloblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -4.900 0.000
medulloblastoma, large-cell -3.900 0.008
primitive neuroectodermal tumor -4.700 0.000
diabetes mellitus 1.100 0.001
adult high grade glioma -4.500 0.000
pilocytic astrocytoma -4.600 0.000
lung carcinoma 1.600 0.000
ovarian cancer -1.100 0.000

Gene RIF (4)

PMID Text
26303144 GPR26 may have a common role in the formation or degradation of intranuclear inclusions in several neurodegenerative diseases
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19787267 epigenetic silencing is a common mechanism in malignant gliomas that simultaneously inactivates MGMT and GPR26
18037267 Study has identified GPR26 to be a genetic indicator of primary glioblastoma, suggesting that it could be a suppressor of primary glioblastoma development.

AA Sequence

MNSWDAGLAGLLVGTMGVSLLSNALVLLCLLHSADIRRQAPALFTLNLTCGNLLCTVVNMPLTLAGVVAQ      1 - 70
RQPAGDRLCRLAAFLDTFLAANSMLSMAALSIDRWVAVVFPLSYRAKMRLRDAALMVAYTWLHALTFPAA     71 - 140
ALALSWLGFHQLYASCTLCSRRPDERLRFAVFTGAFHALSFLLSFVVLCCTYLKVLKVARFHCKRIDVIT    141 - 210
MQTLVLLVDLHPSVRERCLEEQKRRRQRATKKISTFIGTFLVCFAPYVITRLVELFSTVPIGSHWGVLSK    211 - 280
CLAYSKAASDPFVYSLLRHQYRKSCKEILNRLLHRRSIHSSGLTGDSHSQNILPVSE                 281 - 337
//

Text Mined References (13)

PMID Year Title
26303144 2016 G protein-coupled receptor 26 immunoreactivity in intranuclear inclusions associated with polyglutamine and intranuclear inclusion body diseases.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19787267 2009 The 10q25.3-26.1 G protein-coupled receptor gene GPR26 is epigenetically silenced in human gliomas.
18037267 2008 GPR26: a marker for primary glioblastoma?
17363172 2007 Tissue distribution and functional analyses of the constitutively active orphan G protein coupled receptors, GPR26 and GPR78.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...