Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 4
Funding $2,154,529
PubMed Score 6.75
PubTator Score 7.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.100 0.001
posterior fossa group A ependymoma 1.800 0.000
medulloblastoma, large-cell -1.200 0.001
non-small cell lung cancer -1.352 0.000
lung adenocarcinoma -1.600 0.000
group 4 medulloblastoma -1.500 0.000
pancreatic carcinoma 1.100 0.001
Breast cancer -1.300 0.031
ductal carcinoma in situ -1.100 0.005
invasive ductal carcinoma -1.400 0.010
ovarian cancer -1.300 0.000

Synonym

Accession Q8NDV1 Q6PCE0 Q6UX29 Q8N259
Symbols STY
SIAT7C
PRO7177
ST6GALNACIII

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
24740207 genome-wide association study in population in Finland: Data suggest that one SNP in ST6GALNAC3 (rs12144344) and two SNPs in VDBP (vitamin D binding protein; rs7041, rs705117) are associated with serum levels of VDBP in the male population studied.
20421487 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16169874 Results describe the molecular cloning and expression of human ST6GalNAc III, including its tissue distribution and substrate specificity.

AA Sequence

MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQ      1 - 70
EPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNP     71 - 140
DYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQ    141 - 210
SGSYLSTGWFTFLLAMDACYGIHVYGMINDTYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFI    211 - 280
TEKKVFAKWAKKHRIIFTHPNWTLS                                                 281 - 305
//

Text Mined References (17)

PMID Year Title
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24740207 2014 Genome-wide association study of circulating vitamin D-binding protein.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
20421487 2010 Genome-wide association identifies candidate genes that influence the human electroencephalogram.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17123352 2007 Identification and expression of a sialyltransferase responsible for the synthesis of disialylgalactosylgloboside in normal and malignant kidney cells: downregulation of ST6GalNAc VI in renal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...