Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.75
PubTator Score 7.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 3.11755608178072E-17
non-small cell lung cancer 2798 2.46357732664487E-15
ovarian cancer 8492 4.01460361153993E-9
posterior fossa group A ependymoma 1511 6.19266188838945E-9
group 4 medulloblastoma 1875 3.73292851810551E-4
pancreatic cancer 2300 9.85202042323963E-4
pancreatic carcinoma 567 9.85202042323963E-4
medulloblastoma, large-cell 6234 0.00124017951348393
ductal carcinoma in situ 1745 0.00533088934936314
invasive ductal carcinoma 2950 0.0102981582841262
Breast cancer 3099 0.0313919902840339
Disease Target Count Z-score Confidence
Disease of mental health 22 0.0 2.0
Lymphoid leukemia 69 0.0 1.0

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.100 0.001
posterior fossa group A ependymoma 1.800 0.000
medulloblastoma, large-cell -1.200 0.001
non-small cell lung cancer -1.352 0.000
lung adenocarcinoma -1.600 0.000
group 4 medulloblastoma -1.500 0.000
pancreatic carcinoma 1.100 0.001
Breast cancer -1.300 0.031
ductal carcinoma in situ -1.100 0.005
invasive ductal carcinoma -1.400 0.010
ovarian cancer -1.300 0.000

Synonym

Accession Q8NDV1 Q6PCE0 Q6UX29 Q8N259
Symbols STY
SIAT7C
PRO7177
ST6GALNACIII

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (5)

PMID Text
24740207 genome-wide association study in population in Finland: Data suggest that one SNP in ST6GALNAC3 (rs12144344) and two SNPs in VDBP (vitamin D binding protein; rs7041, rs705117) are associated with serum levels of VDBP in the male population studied.
20421487 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16169874 Results describe the molecular cloning and expression of human ST6GalNAc III, including its tissue distribution and substrate specificity.

AA Sequence

MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQ      1 - 70
EPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNP     71 - 140
DYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQ    141 - 210
SGSYLSTGWFTFLLAMDACYGIHVYGMINDTYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFI    211 - 280
TEKKVFAKWAKKHRIIFTHPNWTLS                                                 281 - 305
//

Text Mined References (17)

PMID Year Title
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24740207 2014 Genome-wide association study of circulating vitamin D-binding protein.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
20421487 2010 Genome-wide association identifies candidate genes that influence the human electroencephalogram.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17123352 2007 Identification and expression of a sialyltransferase responsible for the synthesis of disialylgalactosylgloboside in normal and malignant kidney cells: downregulation of ST6GalNAc VI in renal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...