Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.20
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.800 0.006
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -1.700 0.015
glioblastoma -3.500 0.000
osteosarcoma -3.146 0.000
sonic hedgehog group medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -1.300 0.008
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -2.000 0.000
lung carcinoma 1.600 0.000
Pick disease -1.100 0.031
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.100 0.010
ovarian cancer -1.500 0.000

Synonym

Accession Q8NDQ6 A0AVS5 A8K371 Q05D58 Q3LIC5 Q6ZN36 Q7Z3C8 Q86T31
Symbols Nbla10512

Gene

Gene RIF (1)

PMID Text
16815308 Taken together, these results suggest that ZNF540 may act as a transcriptional repressor in MAPK signaling pathway to mediate cellular functions.

AA Sequence

MAHALVTFRDVAIDFSQKEWECLDTTQRKLYRDVMLENYNNLVSLGYSGSKPDVITLLEQGKEPCVVARD      1 - 70
VTGRQCPGLLSRHKTKKLSSEKDIHEISLSKESIIEKSKTLRLKGSIFRNEWQNKSEFEGQQGLKERSIS     71 - 140
QKKIVSKKMSTDRKRPSFTLNQRIHNSEKSCDSHLVQHGKIDSDVKHDCKECGSTFNNVYQLTLHQKIHT    141 - 210
GEKSCKCEKCGKVFSHSYQLTLHQRFHTGEKPYECQECGKTFTLYPQLNRHQKIHTGKKPYMCKKCDKGF    211 - 280
FSRLELTQHKRIHTGKKSYECKECGKVFQLIFYFKEHERIHTGKKPYECKECGKAFSVCGQLTRHQKIHT    281 - 350
GVKPYECKECGKTFRLSFYLTEHRRTHAGKKPYECKECGKSFNVRGQLNRHKTIHTGIKPFACKVCEKAF    351 - 420
SYSGDLRVHSRIHTGEKPYECKECGKAFMLRSVLTEHQRLHTGVKPYECKECGKTFRVRSQISLHKKIHT    421 - 490
DVKPYKCVRCGKTFRFGFYLTEHQRIHTGEKPYKCKECGKAFIRRGNLKEHLKIHSGLKPYDCKECGKSF    491 - 560
SRRGQFTEHQKIHTGVKPYKCKECGKAFSRSVDLRIHQRIHTGEKPYECKQCGKAFRLNSHLTEHQRIHT    561 - 630
GEKPYECKVCRKAFRQYSHLYQHQKTHNVI                                            631 - 660
//

Text Mined References (9)

PMID Year Title
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16815308 2006 A novel human zinc finger protein ZNF540 interacts with MVP and inhibits transcriptional activities of the ERK signal pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.