Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.20
PubTator Score 0.50

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 5.32882871117917E-23
posterior fossa group A ependymoma 1511 6.50439490559026E-22
ovarian cancer 8492 6.30409349590912E-11
atypical teratoid / rhabdoid tumor 4369 3.44310753351286E-10
pediatric high grade glioma 2712 4.64879042451565E-10
osteosarcoma 7933 1.92135842084247E-8
glioblastoma 5572 2.38087812729904E-8
medulloblastoma, large-cell 6234 4.77301449140226E-8
pilocytic astrocytoma 3086 1.46030648585796E-7
Breast cancer 3099 1.77870693155746E-7
sonic hedgehog group medulloblastoma 1482 3.29412562053972E-7
astrocytic glioma 2241 0.00587632390114986
primitive neuroectodermal tumor 3031 0.00846901346352552
invasive ductal carcinoma 2950 0.00961416535173859
oligodendroglioma 2849 0.0145205618918076
Pick disease 1893 0.030750938593998


  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.800 0.006
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -1.700 0.015
glioblastoma -3.500 0.000
osteosarcoma -3.146 0.000
sonic hedgehog group medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -1.300 0.008
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -2.000 0.000
lung carcinoma 1.600 0.000
Pick disease -1.100 0.031
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.100 0.010
ovarian cancer -1.500 0.000


Accession Q8NDQ6 A0AVS5 A8K371 Q05D58 Q3LIC5 Q6ZN36 Q7Z3C8 Q86T31
Symbols Nbla10512


  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid

Gene RIF (1)

16815308 Taken together, these results suggest that ZNF540 may act as a transcriptional repressor in MAPK signaling pathway to mediate cellular functions.

AA Sequence

GEKPYECKVCRKAFRQYSHLYQHQKTHNVI                                            631 - 660

Text Mined References (9)

PMID Year Title
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16815308 2006 A novel human zinc finger protein ZNF540 interacts with MVP and inhibits transcriptional activities of the ERK signal pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.