Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.20
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.700 3.1e-08
astrocytic glioma -1.800 5.9e-03
Astrocytoma, Pilocytic -1.900 1.4e-07
atypical teratoid / rhabdoid tumor -3.700 3.4e-10
Breast cancer -1.400 1.8e-07
ependymoma -1.700 4.4e-02
glioblastoma -2.500 2.3e-10
invasive ductal carcinoma -1.100 9.6e-03
lung carcinoma 1.600 5.3e-23
medulloblastoma -1.600 1.3e-04
medulloblastoma, large-cell -3.500 4.8e-08
oligodendroglioma -1.700 1.5e-02
osteosarcoma -3.146 1.9e-08
ovarian cancer -1.500 6.3e-11
Pick disease -1.100 3.1e-02
primitive neuroectodermal tumor -1.300 8.5e-03

Gene RIF (1)

AA Sequence

MAHALVTFRDVAIDFSQKEWECLDTTQRKLYRDVMLENYNNLVSLGYSGSKPDVITLLEQGKEPCVVARD      1 - 70
VTGRQCPGLLSRHKTKKLSSEKDIHEISLSKESIIEKSKTLRLKGSIFRNEWQNKSEFEGQQGLKERSIS     71 - 140
QKKIVSKKMSTDRKRPSFTLNQRIHNSEKSCDSHLVQHGKIDSDVKHDCKECGSTFNNVYQLTLHQKIHT    141 - 210
GEKSCKCEKCGKVFSHSYQLTLHQRFHTGEKPYECQECGKTFTLYPQLNRHQKIHTGKKPYMCKKCDKGF    211 - 280
FSRLELTQHKRIHTGKKSYECKECGKVFQLIFYFKEHERIHTGKKPYECKECGKAFSVCGQLTRHQKIHT    281 - 350
GVKPYECKECGKTFRLSFYLTEHRRTHAGKKPYECKECGKSFNVRGQLNRHKTIHTGIKPFACKVCEKAF    351 - 420
SYSGDLRVHSRIHTGEKPYECKECGKAFMLRSVLTEHQRLHTGVKPYECKECGKTFRVRSQISLHKKIHT    421 - 490
DVKPYKCVRCGKTFRFGFYLTEHQRIHTGEKPYKCKECGKAFIRRGNLKEHLKIHSGLKPYDCKECGKSF    491 - 560
SRRGQFTEHQKIHTGVKPYKCKECGKAFSRSVDLRIHQRIHTGEKPYECKQCGKAFRLNSHLTEHQRIHT    561 - 630
GEKPYECKVCRKAFRQYSHLYQHQKTHNVI                                            631 - 660
//

Text Mined References (9)

PMID Year Title