Property Summary

NCBI Gene PubMed Count 14
PubMed Score 45.49
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Alcoholic Intoxication, Chronic 41
Disease Target Count P-value
psoriasis 6685 1.1523672978276E-7
pilocytic astrocytoma 3086 5.71736792603955E-5
active Crohn's disease 918 0.00307033034822471
colon cancer 1475 0.034205319544044
chronic rhinosinusitis 512 0.0482272102045849
Disease Target Count Z-score Confidence
Fundus dystrophy 77 3.134 1.6
chronic lymphocytic leukemia 244 3.015 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.500 0.000
colon cancer 1.100 0.034
active Crohn's disease 1.582 0.003
pilocytic astrocytoma 1.500 0.000
chronic rhinosinusitis -1.043 0.048

Synonym

Accession Q8NDN9 Q8IY29 Q969U9
Symbols GLP
CLLD7
CLLL7
RDEOA

Gene

  Ortholog (14)

Gene RIF (4)

PMID Text
24202307 Study identifies RCBTB1 as a modifier of the smoking effect on carotid intima-media thickness.
20926398 Data show that the biological actions of Clld7 are consistent with those of a tumor suppressor.
20085599 Observational study of gene-disease association. (HuGE Navigator)
14565662 E4.5 gene, which maps at chromosome band 13q14.3, encodes for a 4 kb mRNA expressed in various tissues and has an open reading frame of 531 amino acids. It has a potential role in the pathogenesis of chronic lymphocytic leukemia [E4.5]

AA Sequence

MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEG      1 - 70
LCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQVCTNLLIKQVVEVACGSHHS     71 - 140
MALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHIKRVVGIACGQTSSMAVLDNGEVYGWGYNGN    141 - 210
GQLGLGNNGNQLTPVRVAALHSVCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIM    211 - 280
VEKERVVEIAACHSAHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVSWRLLSVEH    281 - 350
EDFLTVAESLKKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPV    351 - 420
YRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEF    421 - 490
CFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASKCGAFKN                                 491 - 531
//

Text Mined References (16)

PMID Year Title
24202307 2014 Genome-wide interaction study identifies RCBTB1 as a modifier for smoking effect on carotid intima-media thickness.
20926398 2010 Clld7, a candidate tumor suppressor on chromosome 13q14, regulates pathways of DNA damage/repair and apoptosis.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14985364 2004 A novel angiotensin II type 1 receptor-associated protein induces cellular hypertrophy in rat vascular smooth muscle and renal proximal tubular cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...