Property Summary

NCBI Gene PubMed Count 14
Grant Count 14
R01 Count 5
Funding $13,031,618.46
PubMed Score 45.49
PubTator Score 6.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.500 0.000
colon cancer 1.100 0.034
active Crohn's disease 1.582 0.003
pilocytic astrocytoma 1.500 0.000
chronic rhinosinusitis -1.043 0.048

Gene RIF (4)

PMID Text
24202307 Study identifies RCBTB1 as a modifier of the smoking effect on carotid intima-media thickness.
20926398 Data show that the biological actions of Clld7 are consistent with those of a tumor suppressor.
20085599 Observational study of gene-disease association. (HuGE Navigator)
14565662 E4.5 gene, which maps at chromosome band 13q14.3, encodes for a 4 kb mRNA expressed in various tissues and has an open reading frame of 531 amino acids. It has a potential role in the pathogenesis of chronic lymphocytic leukemia [E4.5]

AA Sequence

MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEG      1 - 70
LCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQVCTNLLIKQVVEVACGSHHS     71 - 140
MALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHIKRVVGIACGQTSSMAVLDNGEVYGWGYNGN    141 - 210
GQLGLGNNGNQLTPVRVAALHSVCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIM    211 - 280
VEKERVVEIAACHSAHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVSWRLLSVEH    281 - 350
EDFLTVAESLKKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPV    351 - 420
YRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEF    421 - 490
CFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASKCGAFKN                                 491 - 531
//

Text Mined References (16)

PMID Year Title
24202307 2014 Genome-wide interaction study identifies RCBTB1 as a modifier for smoking effect on carotid intima-media thickness.
20926398 2010 Clld7, a candidate tumor suppressor on chromosome 13q14, regulates pathways of DNA damage/repair and apoptosis.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14985364 2004 A novel angiotensin II type 1 receptor-associated protein induces cellular hypertrophy in rat vascular smooth muscle and renal proximal tubular cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...