Property Summary

NCBI Gene PubMed Count 17
PubMed Score 47.66
PubTator Score 6.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.582 3.1e-03
Astrocytoma, Pilocytic 1.500 5.6e-05
chronic rhinosinusitis -1.043 4.8e-02
colon cancer 1.100 3.4e-02
psoriasis -1.500 1.2e-07

Gene RIF (7)

AA Sequence

MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEG      1 - 70
LCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQVCTNLLIKQVVEVACGSHHS     71 - 140
MALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHIKRVVGIACGQTSSMAVLDNGEVYGWGYNGN    141 - 210
GQLGLGNNGNQLTPVRVAALHSVCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIM    211 - 280
VEKERVVEIAACHSAHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVSWRLLSVEH    281 - 350
EDFLTVAESLKKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPV    351 - 420
YRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEF    421 - 490
CFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASKCGAFKN                                 491 - 531
//

Text Mined References (19)

PMID Year Title