Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.27
PubTator Score 4.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 0.020
ependymoma -1.900 0.033
oligodendroglioma -1.700 0.032
cutaneous lupus erythematosus -1.300 0.014
group 4 medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.500 0.003
medulloblastoma, large-cell -2.300 0.000
intraductal papillary-mucinous neoplasm ... -1.400 0.003
lung cancer 2.000 0.000
adult high grade glioma -1.500 0.002
ovarian cancer 1.400 0.000

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
26720455 Due to the characteristic Retinitis Pigmentosa phenotype in patients carrying the AGBL5 missense mutation we suggest this gene as a candidate for a new form of autosomal recessively inherited RP
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of ATP/GTP binding protein-like 5 (AGBL5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MELRCGGLLFSSRFDSGNLAHVEKVESLSSDGEGVGGGASALTSGIASSPDYEFNVWTRPDCAETEFENG      1 - 70
NRSWFYFSVRGGMPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPTRPRWERIRDRPTFEMTETQFVLSFV     71 - 140
HRFVEGRGATTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYHRELLCYSLDGLRVDLLTI    141 - 210
TSCHGLREDREPRLEQLFPDTSTPRPFRFAGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTL    211 - 280
RRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNSQSSSEH    281 - 350
QPSSCLPPDAPVSDLEKANNLQNEAQCGHSADRHNAEAWKQTEPAEQKLNSVWIMPQQSAGLEESAPDTI    351 - 420
PPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRR    421 - 490
DGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGR    491 - 560
AMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVS    561 - 630
CSENTLSRARSFSTGTSAGGSSSSQQNSPQMKNSPSFPFHGSRPAGLPGLGSSTQKVTHRVLGPVREPRS    631 - 700
QDRRRQQQPLNHRPAGSLAPSPAPTSSGPASSHKLGSCLLPDSFNIPGSSCSLLSSGDKPEAVMVIGKGL    701 - 770
LGTGARMPCIKTRLQARPRLGRGSPPTRRGMKGSSGPTSPTPRTRESSELELGSCSATPGLPQARPPRPR    771 - 840
SAPAFSPISCSLSDSPSWNCYSRGPLGQPEVCFVPKSPPLTVSPRV                            841 - 886
//

Text Mined References (16)

PMID Year Title
26829768 2016 Glutamylation of the DNA sensor cGAS regulates its binding and synthase activity in antiviral immunity.
26739754 2016 Evidence for new C-terminally truncated variants of ?- and ?-tubulins.
26720455 2015 Exome Sequencing Reveals AGBL5 as Novel Candidate Gene and Additional Variants for Retinitis Pigmentosa in Five Turkish Families.
26355662 2016 Expanding the clinical, allelic, and locus heterogeneity of retinal dystrophies.
24022482 2013 Cytosolic carboxypeptidase 5 removes ?- and ?-linked glutamates from tubulin.
23085998 2013 Functional segregation and emerging role of cilia-related cytosolic carboxypeptidases (CCPs).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...