Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.52
PubTator Score 4.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 2.3e-03
astrocytic glioma -1.800 2.0e-02
atypical teratoid / rhabdoid tumor 1.200 3.4e-05
cutaneous lupus erythematosus -1.300 1.4e-02
ependymoma -1.900 3.3e-02
glioblastoma -1.500 3.2e-03
group 3 medulloblastoma 1.100 1.3e-02
intraductal papillary-mucinous neoplasm ... -1.400 2.7e-03
lung cancer 2.000 9.6e-05
medulloblastoma, large-cell 1.200 6.2e-04
oligodendroglioma -1.700 3.2e-02
ovarian cancer 1.400 1.9e-04

Gene RIF (6)

AA Sequence

MELRCGGLLFSSRFDSGNLAHVEKVESLSSDGEGVGGGASALTSGIASSPDYEFNVWTRPDCAETEFENG      1 - 70
NRSWFYFSVRGGMPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPTRPRWERIRDRPTFEMTETQFVLSFV     71 - 140
HRFVEGRGATTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYHRELLCYSLDGLRVDLLTI    141 - 210
TSCHGLREDREPRLEQLFPDTSTPRPFRFAGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTL    211 - 280
RRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNSQSSSEH    281 - 350
QPSSCLPPDAPVSDLEKANNLQNEAQCGHSADRHNAEAWKQTEPAEQKLNSVWIMPQQSAGLEESAPDTI    351 - 420
PPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRR    421 - 490
DGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGR    491 - 560
AMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVS    561 - 630
CSENTLSRARSFSTGTSAGGSSSSQQNSPQMKNSPSFPFHGSRPAGLPGLGSSTQKVTHRVLGPVREPRS    631 - 700
QDRRRQQQPLNHRPAGSLAPSPAPTSSGPASSHKLGSCLLPDSFNIPGSSCSLLSSGDKPEAVMVIGKGL    701 - 770
LGTGARMPCIKTRLQARPRLGRGSPPTRRGMKGSSGPTSPTPRTRESSELELGSCSATPGLPQARPPRPR    771 - 840
SAPAFSPISCSLSDSPSWNCYSRGPLGQPEVCFVPKSPPLTVSPRV                            841 - 886
//

Text Mined References (18)

PMID Year Title