Property Summary

NCBI Gene PubMed Count 27
Grant Count 10
R01 Count 5
Funding $417,063.18
PubMed Score 7.16
PubTator Score 4.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (14)

PMID Text
21071540 Observational study of gene-disease association. (HuGE Navigator)
20878950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20717903 Observational study of gene-disease association. (HuGE Navigator)
20690139 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20468071 Observational study of gene-disease association. (HuGE Navigator)
20460480 Observational study of gene-disease association. (HuGE Navigator)
20450899 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19902474 Observational study of gene-disease association. (HuGE Navigator)
19900942 Observational study of gene-disease association. (HuGE Navigator)
19866473 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVV      1 - 70
VWPVPENIEITVTLFKDPHAEEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKP     71 - 140
LSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQADIGNLDDFEEDNEDDDENRVNQEEKAAKI    141 - 210
TEIVNQLNALSSLDEDQDDCIKQANMRSAKSASSSEELINKLNFLDEAEKDLATVNSNPFDDPDAAELNP    211 - 280
FGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDM    281 - 350
SKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETERRVKRKAPAPPVLSPKTGVLNENTVS    351 - 420
AGKDLSTSPKPSPIPSPVLGRKPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLI    421 - 490
DYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSGQELNVVQIEEN    491 - 560
SSKSTYKVGNYETDTNSSVDQEKFYAELSDLKREPELQQPISGAVDFLSQDDSVFVNDSGVGESESEHQT    561 - 630
PDDHLSPSTASPYCRRTKSDTEPQKSQQSSGRTSGSDDPGICSNTDSTQAQVLLGKKRLLKAETLELSDL    631 - 700
YVSDKKKDMSPPFICEETDEQKLQTLDIGSNLEKEKLENSRSLECRSDPESPIKKTSLSPTSKLGYSYSR    701 - 770
DLDLAKKKHASLRQTESDPDADRTTLNHADHSSKIVQHRLLSRQEELKERARVLLEQARRDAALKAGNKH    771 - 840
NTNTATPFCNRQLSDQQDEERRRQLRERARQLIAEARSGVKMSELPSYGEMAAEKLKERSKASGDENDNI    841 - 910
EIDTNEEIPEGFVVGGGDELTNLENDLDTPEQNSKLVDLKLKKLLEVQPQVANSPSSAAQKAVTESSEQD    911 - 980
MKSGTEDLRTERLQKTTERFRNPVVFSKDSTVRKTQLQSFSQYIENRPEMKRQRSIQEDTKKGNEEKAAI    981 - 1050
TETQRKPSEDEVLNKGFKDTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWF   1051 - 1120
MLVNKKNALIRRMNQLSLLEKEHDLERRYELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVALVNKRD   1121 - 1190
ALVRDLDAQEKQAEEEDEHLERTLEQNKGKMAKKEEKCVLQ                                1191 - 1231
//

Text Mined References (40)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20878950 2011 Inherited genetic markers discovered to date are able to identify a significant number of men at considerably elevated risk for prostate cancer.
20717903 2011 Evidence for an association between prostate cancer and chromosome 8q24 and 10q11 genetic variants in African American men: the Flint Men's Health Study.
20690139 2011 Meta-analysis of genome-wide and replication association studies on prostate cancer.
More...