Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.72
PubTator Score 0.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.18233422938778E-8
pituitary cancer 1972 8.1687085381985E-8
posterior fossa group B ependymoma 1530 3.92354669199256E-6
tuberculosis 1563 6.01510103370243E-6
pilocytic astrocytoma 3086 7.68261305200423E-6
pediatric high grade glioma 2712 4.95235758535337E-4
sonic hedgehog group medulloblastoma 1482 6.60463338824148E-4
glioblastoma 5572 0.00102963311202857
primitive neuroectodermal tumor 3031 0.00338285050388772
Rheumatoid Arthritis 1171 0.00707566363676864
pancreatic carcinoma 567 0.00853072557870058
pancreatic cancer 2300 0.00853072557870064
astrocytic glioma 2241 0.00858184037193554
medulloblastoma, large-cell 6234 0.0441378987106623
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0
Disease Target Count Z-score Confidence
Azoospermia 89 3.634 1.8

Expression

  Differential Expression (14)

Synonym

Accession Q8NDG6 A1A4S7 Q6ZU54 Q8N7T3 Q8N827 Q8N9V5 Q96AS9
Symbols HIG-1
NET54
C14orf75

Gene

  Ortholog (14)

 GWAS Trait (1)

Gene RIF (3)

PMID Text
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20414141 Observational study of gene-disease association. (HuGE Navigator)
19308021 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRKLTIEQINDWFTIGKTVTNVELLGAPPAFPAGAAREEVQRQDVAPGAGPAAQAPALAQAPARPAAAF      1 - 70
ERSLSQRSSEVEYINKYRQLEAQELDVCRSVQPTSGPGPRPSLAKLSSVTCIPGTTYKYPDLPISRYKEE     71 - 140
VVSLIESNSVVIIHGATGSGKSTQLPQYILDHYVQRSAYCSIVVTQPRKIGASSIARWISKERAWTLGGV    141 - 210
VGYQVGLEKIATEDTRLIYMTTGVLLQKIVSAKSLMEFTHIIIDEVHERTEEMDFLLLVVRKLLRTNSRF    211 - 280
VKVVLMSATISCKEFADYFAVPVQNKMNPAYIFEVEGKPHSVEEYYLNDLEHIHHSKLSPHLLEEPVITK    281 - 350
DIYEVAVSLIQMFDDLDMKESGNKAWSGAQFVLERSSVLVFLPGLGEINYMHELLTSLVHKRLQVYPLHS    351 - 420
SVALEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSC    421 - 490
NQRKGRAGRVSRGYCYRLVHKDFWDNSIPDHVVPEMLRCPLGSTILKVKLLDMGEPRALLATALSPPGLS    491 - 560
DIERTILLLKEVGALAVSGQREDENPHDGELTFLGRVLAQLPVNQQLGKLIVLGHVFGCLDECLIIAAAL    561 - 630
SLKNFFAMPFRQHLDGYRNKVNFSGSSKSDCIALVEAFKTWKACRQTGELRYPKDELNWGRLNYIQIKRI    631 - 700
REVAELYEELKTRISQFNMHVDSRRPVMDQEYIYKQRFILQVVLAGAFYPNYFTFGQPDEEMAVRELAGK    701 - 770
DPKTTVVLKHIPPYGFLYYKQLQSLFRQCGQVKSIVFDGAKAFVEFSRNPTERFKTLPAVYMAIKMSQLK    771 - 840
VSLELSVHSAEEIEGKVQGMNVSKLRNTRVNVDFQKQTVDPMQVSFNTSDRSQTVTDLLLTIDVTEVVEV    841 - 910
GHFWGYRIDENNSEILKKLTAEINQLTLVPLPTHPHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFF    911 - 980
VDYGNKSHVDLHLLMEIPCQFLELPFQALEFKICKMRPSAKSLVCGKHWSDGASQWFASLVSGCTLLVKV    981 - 1050
FSVVHSVLHVDVYQYSGVQDAINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM   1051 - 1120
KDDEKYLIRILLESFSTNKLGTPNCKAELHGPFNPYELKCHSLTRISKFRCVWIEKESINSVIISDAPED   1121 - 1190
LHQRMLVAASLSINATGSTMLLRETSLMPHIPGLPALLSMLFAPVIELRIDQNGKYYTGVLCGLGWNPAT   1191 - 1260
GASILPEHDMELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIARQKLLGLFCQS   1261 - 1330
KPREKIVPKWHEKPYEWNQVDPKLVMEQADRESSRGKNTFLYQLHKLVVLGT                     1331 - 1382
//

Text Mined References (10)

PMID Year Title
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20414141 2010 Family-based association study for bipolar affective disorder.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.