Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.45
PubTator Score 5.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.018
osteosarcoma 1.021 0.004
ependymoma -1.200 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.200 0.001
adrenocortical carcinoma 1.288 0.000
adult high grade glioma -1.400 0.000
pilocytic astrocytoma -1.100 0.000

Gene RIF (3)

PMID Text
25049417 PAPD5 and PARN mediate degradation of oncogenic miRNA miR-21.
21788334 PAPD5 catalyzes the polyadenylation of different types of RNA substrates in vitro.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPAD      1 - 70
SASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKM     71 - 140
RMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVK    141 - 210
VLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGG    211 - 280
IGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNML    281 - 350
DGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDE    351 - 420
VATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLE    421 - 490
SSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRK    491 - 560
HKRDAPLSDLCR                                                              561 - 572
//

Text Mined References (16)

PMID Year Title
25049417 2014 PAPD5-mediated 3' adenylation and subsequent degradation of miR-21 is disrupted in proliferative disease.
23376078 2013 Molecular cloning and characterization of a novel isoform of the non-canonical poly(A) polymerase PAPD7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22817747 2012 Comparison of the yeast and human nuclear exosome complexes.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21788334 2011 PAPD5, a noncanonical poly(A) polymerase with an unusual RNA-binding motif.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18172165 2008 Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'.
More...