Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.57
PubTator Score 5.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Dyskeratosis congenita 24 4.382 2.2

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.288 9.4e-06
adult high grade glioma -1.400 4.3e-05
Astrocytoma, Pilocytic -1.100 2.0e-05
ependymoma -1.200 1.5e-08
glioblastoma -1.300 2.8e-09
medulloblastoma, large-cell -1.200 1.4e-03
osteosarcoma 1.021 3.6e-03
Rheumatoid arthritis 1.200 1.8e-02

 GO Component (2)

Gene RIF (5)

AA Sequence

MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPAD      1 - 70
SASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKM     71 - 140
RMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVK    141 - 210
VLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGG    211 - 280
IGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNML    281 - 350
DGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDE    351 - 420
VATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLE    421 - 490
SSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRK    491 - 560
HKRDAPLSDLCR                                                              561 - 572
//

Text Mined References (20)

PMID Year Title